SNAPIN Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85949-1-RR (same clone as 85949-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85949-1-RR (SNAPIN antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85949-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85949-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85949-1-RR against Human SNAPIN were performed. The affinity constant is 7.37 nM.

SNAPIN Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85949-1-PBS

Clone No.250300F4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Biogenesis of lysosome-related organelles complex 1 subunit 7, BLOC-1 subunit 7, BLOC1S7, SNAP associated protein, SNAP25BP

---

Product Information

85949-1-PBS targets SNAPIN in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0101

  Product name: Recombinant human SNAPIN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-136 aa of BC000761

  Sequence: MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK

• Full Name: SNAP-associated protein
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 15-18 kDa
• GenBank Accession Number: BC000761
• Gene Symbol: SNAPIN
• Gene ID (NCBI): 23557
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95295
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Snapin, a protein of relative molecular weight of 15kd, is implicated in neurotransmission by binding to SNAP-25. Snapin was enriched in neurons and exclusively located on synaptic vesicle membrane, which may be a PKA target for modulating transmitter release through the cAMP-dependent signal-transduction pathway. This anitbody can recognize the 15-18kd(Monomer) and 30-36kd(Dimer) forms of SNAPIN.