Tested Applications
| Positive WB detected in | mouse placenta tissue, human placenta tissue, human brain tissue |
| Positive IHC detected in | mouse brain tissue, human hepatocirrhosis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 3 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
20407-1-AP targets SNRPE in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14227 Product name: Recombinant human SNRPE protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC002639 Sequence: MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN Predict reactive species |
| Full Name | small nuclear ribonucleoprotein polypeptide E |
| Calculated Molecular Weight | 92 aa, 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC002639 |
| Gene Symbol | SNRPE |
| Gene ID (NCBI) | 6635 |
| RRID | AB_10699882 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62304 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The snRNP E (SNRPE)protein is one of several proteins associated with the U family of small nuclear RNAs that are involved in RNA processing. It functions in the U7 snRNP complex that is involved in histone 3'-end processing and also associated with snRNP U1, U2, U4/U6 and U5. This antibody raises against the full length of human SNRPE, and can recognize two bands of SNRPE, include a 9 kDa band(isoform) and a 11kDa band(SNRPE) (PMID:23246290)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SNRPE antibody 20407-1-AP | Download protocol |
| WB protocol for SNRPE antibody 20407-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Am J Hum Genet Mutations in SNRPE, which encodes a core protein of the spliceosome, cause autosomal-dominant hypotrichosis simplex. | ||
J Pathol A novel protein-based prognostic signature improves risk stratification to guide clinical management in early-stage lung adenocarcinoma patients. | ||
Front Immunol Multi-omics analysis and experiments uncover the function of cancer stemness in ovarian cancer and establish a machine learning-based model for predicting immunotherapy responses
| ||













