CoraLite® Plus 488-conjugated SNX5 Monoclonal antibody

• 

  FC experiment of HeLa using CL488-67665

  1X10^6 HeLa cells were intracellularly stained with 0.8 ug CoraLite® Plus 488 Anti-Human SNX5 (CL488-67665, Clone:2F8A4) (red), or 0.8 ug CoraLite® Plus 488 Mouse IgG2a Isotype Control (C1.18.4) (CL488-65208, Clone: C1.18.4) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

SNX5 Monoclonal Antibody for FC (Intra)

Cat No. CL488-67665

Clone No.2F8A4

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat

Applications

FC (Intra)

Synonyms

Sorting nexin-5, 2F8A4

---

Tested Applications

• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67665 targets SNX5 in FC (Intra) applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12330

  Product name: Recombinant human SNX5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-404 aa of BC093623

  Sequence: MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN

• Full Name: sorting nexin 5
• Calculated Molecular Weight: 404 aa, 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC093623
• Gene Symbol: SNX5
• Gene ID (NCBI): 27131
• RRID: AB_3084370
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y5X3
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Sorting nexins are a diverse group of cytoplasmic and membrane-associated proteins that are classified by the presence of a phospholipid-binding motif-the PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. SNX5 (Sorting nexin-5) was originally identified as a putative FANCA-binding protein (PMID: 10600472). SNX5 has a phox homology (PX) domain in the N-terminus. It is involved in several stages of intracellular trafficking. SNX5 is a component of the mammalian retromer complex, which is involved in recycling proteins from endosomes to the trans-Golgi network or plasma membrane (PMID: 17148574; 26199408).