CoraLite®594-conjugated SNX5 Monoclonal antibody

SNX5 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-67665
Clone No.2F8A4

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat

Applications

IF/ICC, FC (Intra)

Sorting nexin-5, 2F8A4

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67665 targets SNX5 in IF/ICC, FC (Intra) applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12330

Product name: Recombinant human SNX5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-404 aa of BC093623

Sequence: MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN

Predict reactive species
Full Name sorting nexin 5
Calculated Molecular Weight 404 aa, 47 kDa
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC093623
Gene Symbol SNX5
Gene ID (NCBI) 27131
RRIDAB_2920168
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y5X3
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Sorting nexins are a diverse group of cytoplasmic and membrane-associated proteins that are classified by the presence of a phospholipid-binding motif-the PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. SNX5 (Sorting nexin-5) was originally identified as a putative FANCA-binding protein (PMID: 10600472). SNX5 has a phox homology (PX) domain in the N-terminus. It is involved in several stages of intracellular trafficking. SNX5 is a component of the mammalian retromer complex, which is involved in recycling proteins from endosomes to the trans-Golgi network or plasma membrane (PMID: 17148574; 26199408).

Protocols

Product Specific Protocols
IF protocol for CL594 SNX5 antibody CL594-67665Download protocol
FC protocol for CL594 SNX5 antibody CL594-67665Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...