CoraLite®594-conjugated SOX10 Monoclonal antibody

• 

  IF Staining of mouse brain using CL594-66786

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using CoraLite®594-conjugated SOX10 antibody (CL594-66786, Clone: 1D2C8 ) at dilution of 1:100.

• 

  IF Staining of mouse brain using CL594-66786

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using CoraLite®594 SOX10 antibody (CL594-66786, Clone: 1D2C8 ) at dilution of 1:200. DAPI (blue).

• 

  IF Staining of rat brain using CL594-66786

  Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using CoraLite®594 SOX10 antibody (CL594-66786, Clone: 1D2C8 ) at dilution of 1:200.

• 

  IF Staining of rat brain using CL594-66786

  Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using CoraLite®594 SOX10 antibody (CL594-66786, Clone: 1D2C8 ) at dilution of 1:200.

• 

  FC experiment of C6 using CL594-66786

  1X10^6 C6 cells were intracellularly stained with 0.8 ug CoraLite®594 Anti-Human SOX10 (CL594-66786, Clone:1D2C8) (red), or 0.8 ug CoraLite®594 Mouse IgG2a Isotype Control (C1.18.4) (CL594-65208, Clone: C1.18.4) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• KD/KO Validated

SOX10 Monoclonal Antibody for IF-P, FC (Intra)

Cat No. CL594-66786

Clone No.1D2C8

Publications(2)

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

IF-P, FC (Intra)

Synonyms

Transcription factor SOX-10, Transcription factor SOX 10, SRY-box transcription factor 9, PCWH, DOM

---

Tested Applications

• Positive IF-P detected in: mouse brain tissue, rat brain tissue
• Positive FC (Intra) detected in: C6 cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

CL594-66786 targets SOX10 in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23191

  Product name: Recombinant human SOX10 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 267-466 aa of BC002824

  Sequence: GKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP

• Full Name: SRY (sex determining region Y)-box 10
• Calculated Molecular Weight: 50 kDa
• GenBank Accession Number: BC002824
• Gene Symbol: SOX10
• Gene ID (NCBI): 6663
• RRID: AB_2920037
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Excitation Laser: Yellow-Green Laser (561 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P56693
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Sox10 is a transcription factor that has a crucial role in complex signalling pathways regulating central nervous system and neural crest development. The calcualted molecular weight of SOX10 is 50 kDa, but modified SOX10 is about 55-60 kDa. (PMID: 23799842)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human		Adv Sci (Weinh); Depletion of p75NTR in Schwann Cells Driven by Inflammation Mediates Cutaneous Pain in Psoriasis.; Authors - Yibo Wang
mouse	IF	Nat Commun; Suppressing recurrence in Sonic Hedgehog subgroup medulloblastoma using the OLIG2 inhibitor CT-179; Authors - Yuchen Li