Tested Applications
| Positive WB detected in | A375 cells, MDA-MB-453 cells |
| Positive IHC-Autostainer detected in | human appendicitis tissue, human skin cancer tissue, human malignant melanoma tissue, human breast tissue |
| Positive IHC detected in | human malignant melanoma tissue, human pituitary adenoma tissue, mouse brain tissue, rat cerebellum tissue, human breast tissue, human skin cancer tissue, human appendicitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat brain tissue, mouse brain tissue |
| Positive IF-Fro detected in | mouse brain tissue |
| Positive FC (Intra) detected in | C6 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC)-AUTOSTAINER | IHC-AUTOSTAINER : 1:5000-1:20000 |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66786-1-Ig targets SOX10 in WB, IHC, IHC-Autostainer, IF-P, IF-Fro, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, rabbit, chicken, zebrafish |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23191 Product name: Recombinant human SOX10 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 267-466 aa of BC002824 Sequence: GKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP Predict reactive species |
| Full Name | SRY (sex determining region Y)-box 10 |
| Calculated Molecular Weight | 50 kDa |
| Observed Molecular Weight | 55-60 kDa |
| GenBank Accession Number | BC002824 |
| Gene Symbol | SOX10 |
| Gene ID (NCBI) | 6663 |
| RRID | AB_2882131 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P56693 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Sox10 is a transcription factor that has a crucial role in complex signalling pathways regulating central nervous system and neural crest development. The calcualted molecular weight of SOX10 is 50 kDa, but modified SOX10 is about 55-60 kDa. (PMID: 23799842).SOX10 sumoylation by UBC9 (sumo-conjugating enzyme UBC9) is the best described one. Occurring at lysines K55, K246 and K357,19 it inhibits NC development and promotes development of non-sensory cranial placodes in vivo.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for SOX10 antibody 66786-1-Ig | Download protocol |
| IF protocol for SOX10 antibody 66786-1-Ig | Download protocol |
| IHC protocol for SOX10 antibody 66786-1-Ig | Download protocol |
| WB protocol for SOX10 antibody 66786-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
SOX10 Monoclonal Antibody (1D2C8), catalog number 66786-1-Ig, has 34 citations. Citations appear in journals including Nature Communications, Molecular Cancer, Molecular Cell, Nucleic Acids Research, Journal of Neuroinflammation, Stem Cells, Progress in Neurobiology, Developmental Biology, eLife, and others. Research fields span neural crest development, Schwann cell biology, melanoma, demyelination, nerve regeneration, oligodendrocyte differentiation, hearing loss, and astrocyte biology, with applications primarily in IF, WB, and IHC.
| Species | Application | Title |
|---|---|---|
Nat Commun Brown adipose tissue secretes OLFM4 to coordinate sensory and sympathetic innervation via Schwann cells | ||
Nucleic Acids Res SRSF10 regulates oligodendrocyte differentiation during mouse central nervous system development by modulating pre-mRNA splicing | ||
J Neuroinflammation SIRT6 modulates lesion microenvironment in LPC induced demyelination by targeting astrocytic CHI3L1 |
Reviews
What customers say
Users report positive results with this antibody across applications. One reviewer used it at 1/200 for immunofluorescence on mouse sciatic nerve sections, noting it worked well in longitudinal sections. Another used it at 1:500–1:1000 for immunohistochemistry on chicken embryos, emphasizing the importance of extensive washing between primary and secondary steps. Overall ratings are 4 and 5 stars, reflecting reliable performance in both IF and IHC contexts.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sonia (Verified Customer) (07-24-2019) | Works fine in longitudinal section of mouse sciatic nerve
 |
Crystal (Verified Customer) (02-19-2019) | Works great in chicken embryos! We used 1:500-1:1000 dilution for the primary and made sure to wash it extensively between primary and secondary.
|
