SPDEF Polyclonal antibody

• 

  WB analysis of MCF-7 using 11467-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 11467-1-AP (SPDEF Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 11467-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 11467-1-AP (SPDEF Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 11467-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 11467-1-AP (SPDEF Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

SPDEF Polyclonal Antibody for WB, ELISA

Cat No. 11467-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

Prostate-derived Ets factor, Prostate specific Ets, Prostate epithelium-specific Ets transcription factor, Prostate derived Ets factor, PDEF

---

Tested Applications

• Positive WB detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 10 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

11467-1-AP targets SPDEF in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2020

  Product name: Recombinant human SPDEF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-335 aa of BC021299

  Sequence: MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI

• Full Name: SAM pointed domain containing ets transcription factor
• Calculated Molecular Weight: 335 aa, 38 kDa
• Observed Molecular Weight: 38-44 kDa
• GenBank Accession Number: BC021299
• Gene Symbol: SPDEF
• Gene ID (NCBI): 25803
• RRID: AB_2877765
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95238
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell; A modular master regulator landscape controls cancer transcriptional identity.; Authors - Evan O Paull
human	WB,IHC	Clin Sci (Lond); Gut microbiota-derived butyrate regulates gut mucus barrier repair by activating the macrophage/WNT/ERK signaling pathway.; Authors - Liping Liang
human	WB,IF	Phytomedicine; Resveratrol inhibits MUC5AC expression by regulating SPDEF in lung cancer cells.; Authors - Yu-Hua Lin
mouse	WB	Food Funct; EPA and DHA differentially coordinate the crosstalk between host and gut microbiota and block DSS-induced colitis in mice by a reinforced colonic mucus barrier.; Authors - Jian Fang
mouse	WB	Immunobiology; Lactobacillus rhamnosus 76 alleviates airway inflammation in ovalbumin-allergic mice and improves mucus secretion by down-regulating STAT6/SPDEF pathway; Authors - Yangfan Hou
rat	WB	Dig Dis Sci; Compromised Ileal Mucus Barrier Due to Impaired Epithelial Homeostasis Caused by Notch1 Signaling in Cirrhotic Rats.; Authors - Linhao Zhang