SPINT3 Polyclonal antibody

• 

  WB analysis using 31931-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31931-1-AP (SPINT3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 31931-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31931-1-AP (SPINT3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A431 using 31931-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using SPINT3 antibody (31931-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

SPINT3 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 31931-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

HKIB9, Kunitz-type protease inhibitor 3

---

Tested Applications

• Positive WB detected in: A431 cells, mouse testis tissue, A549 cells, mouse epididymis tissue, rat testis tissue
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31931-1-AP targets SPINT3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35289

  Product name: Recombinant human SPINT3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-89 aa of NM_006652.1

  Sequence: RDTIKDLLPNVCAFPMEKGPCQTYMTRWFFNFETGECELFAYGGCGGNSNNFLRKEKCEKFCKFT

• Full Name: serine peptidase inhibitor, Kunitz type, 3
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: NM_006652.1
• Gene Symbol: SPINT3
• Gene ID (NCBI): 10816
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P49223
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Serine peptidase inhibitor, Kunitz type 3 (SPINT3, also known as HKIB9) might be related to serine-type endopeptidase inhibitor activity, receptor antagonist activity, and transforming growth factor beta binding (PMID: 21988899). The calculated molecular weight of SPINT3 is 10 kDa, which is lower than its observed molecular weight of 30-35 kDa by SDS-PAGE detection (PMID: 21988899).