Tested Applications
| Positive WB detected in | PC-12 cells, MCF-7 cells, mouse testis tissue, mouse brain tissue, rat brain tissue, T-47D cells, rat testis tissue |
| Positive IHC detected in | rat testis tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 4 publications below |
| IHC | See 3 publications below |
| IF | See 1 publications below |
Product Information
24091-1-AP targets SPRED2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21359 Product name: Recombinant human SPRED2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 122-214 aa of BC136334 Sequence: LIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMPRPYRQVSFPDDDEEI Predict reactive species |
| Full Name | sprouty-related, EVH1 domain containing 2 |
| Calculated Molecular Weight | 418 aa, 48 kDa |
| Observed Molecular Weight | 40-48 kDa |
| GenBank Accession Number | BC136334 |
| Gene Symbol | SPRED2 |
| Gene ID (NCBI) | 200734 |
| RRID | AB_2879429 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | Q7Z698 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SPRED2 is a member of the SPRED family of proteins that modulate GFR signaling by inhibiting the Ras-MAPK cascade (PMID: 17094949). SPRED family members are characterized by an N-terminal Enabled/VASP homology 1 domain (EVH1), a central c-Kit binding domain (KBD) and a C-terminal Sprouty-related domain (SPR) (PMID: 17691106). Three mammalian SPREDs (SPRED1-3) have been described. In adult tissues, SPRED2 is expressed ubiquitously, but most highly expressed in glandular epithelia (PMID: 15580519; 17691106). Reduced expression level of SPRED2 has been reported in human hepatocellular carcinoma (HCC), suggesting SPRED2 may play a role in tumorgenesis (PMID: 16652141). Gene disruption of SPRED2 causes dwarfism (PMID: 15946934).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SPRED2 antibody 24091-1-AP | Download protocol |
| IHC protocol for SPRED2 antibody 24091-1-AP | Download protocol |
| WB protocol for SPRED2 antibody 24091-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biol Pharm Bull Inhibition of Spred/Sprouty Expression in the Skin of a Contact Dermatitis-Like Model. | ||
Int J Mol Sci SPRED2 Is a Novel Regulator of Autophagy in Hepatocellular Carcinoma Cells and Normal Hepatocytes
| ||
Int J Mol Sci SPRED2: A Novel Regulator of Epithelial-Mesenchymal Transition and Stemness in Hepatocellular Carcinoma Cells | ||
Histol Histopathol microRNA-141-3p mediates epithelial cell proliferation, apoptosis, and epithelial-mesenchymal transition and alleviates pulmonary fibrosis in mice via Spred2 |























