SPRED2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SPRED2 Polyclonal antibody (24091-1-AP)

• Featured Product
• KD/KO Validated

SPRED2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 24091-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Sprouty-related, EVH1 domain-containing protein 2, Spred-2

• 

  WB analysis of MCF-7 using 24091-1-AP

  WB result of SPRED2 antibody (24091-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SPRED2 transfected MCF-7 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 24091-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24091-1-AP (SPRED2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-12 using 24091-1-AP

  PC-12 cells were subjected to SDS PAGE followed by western blot with 24091-1-AP (SPRED2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 24091-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 24091-1-AP (SPRED2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 24091-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 24091-1-AP (SPRED2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat brain using 24091-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 24091-1-AP (SPRED2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 24091-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24091-1-AP (SPRED2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 24091-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24091-1-AP (SPRED2 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 24091-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24091-1-AP (SPRED2 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat testis using 24091-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 24091-1-AP (SPRED2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat testis using 24091-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 24091-1-AP (SPRED2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 24091-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 24091-1-AP (SPRED2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SPRED2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: PC-12 cells, MCF-7 cells, mouse testis tissue, mouse brain tissue, rat brain tissue, T-47D cells, rat testis tissue
• Positive IHC detected in: rat testis tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24091-1-AP targets SPRED2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21359

  Product name: Recombinant human SPRED2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 122-214 aa of BC136334

  Sequence: LIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMPRPYRQVSFPDDDEEI

• Full Name: sprouty-related, EVH1 domain containing 2
• Calculated Molecular Weight: 418 aa, 48 kDa
• Observed Molecular Weight: 40-48 kDa
• GenBank Accession Number: BC136334
• Gene Symbol: SPRED2
• Gene ID (NCBI): 200734
• RRID: AB_2879429
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q7Z698
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPRED2 is a member of the SPRED family of proteins that modulate GFR signaling by inhibiting the Ras-MAPK cascade (PMID: 17094949). SPRED family members are characterized by an N-terminal Enabled/VASP homology 1 domain (EVH1), a central c-Kit binding domain (KBD) and a C-terminal Sprouty-related domain (SPR) (PMID: 17691106). Three mammalian SPREDs (SPRED1-3) have been described. In adult tissues, SPRED2 is expressed ubiquitously, but most highly expressed in glandular epithelia (PMID: 15580519; 17691106). Reduced expression level of SPRED2 has been reported in human hepatocellular carcinoma (HCC), suggesting SPRED2 may play a role in tumorgenesis (PMID: 16652141). Gene disruption of SPRED2 causes dwarfism (PMID: 15946934).

Publications

What published studies show

The SPRED2 antibody (Cat# 24091-1-AP) has 8 total citations. These appear in journals including Int J Mol Sci, Pathol Res Pract, PLoS One, J Mol Neurosci, Histol Histopathol, and Biol Pharm Bull. Research fields span hepatocellular carcinoma, breast cancer, lung adenocarcinoma, urothelial tumorigenesis, neuronal autophagy, pulmonary fibrosis, and contact dermatitis. Applications include WB, IHC, and IF in human and mouse samples.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Int J Mol Sci; SPRED2: A Novel Regulator of Epithelial-Mesenchymal Transition and Stemness in Hepatocellular Carcinoma Cells; Authors - Tong Gao
human	IHC	Int J Mol Sci; Neurofibromin Encoded by the Neurofibromatosis Type 1 (NF1) Gene Promotes the Membrane Translocation of SPRED2, Thereby Inhibiting the ERK Pathway in Breast Cancer Cells.; Authors - Nang Thee Su Pwint ; KD Validated
human,mouse	WB,IHC	Int J Mol Sci; SPRED2 Is a Novel Regulator of Autophagy in Hepatocellular Carcinoma Cells and Normal Hepatocytes; Authors - Tianyi Wang ; KO Validated
human	WB,IHC	Pathol Res Pract; Expression of SPRED2 in the lung adenocarcinoma; Authors - Yoko Ota
human	IHC	PLoS One; Expression of Spred2 in the urothelial tumorigenesis of the urinary bladder; Authors - Shinsuke Oda
mouse	WB	J Mol Neurosci; TRIM25 Suppresses Hippocampal Neuronal Autophagy under High Glucose via Ubiquitination and Degradation of SIX2.; Authors - Li Chen ; KD Validated