Tested Applications
Positive WB detected in | HSC-T6 cells, HeLa cells, HEK-293 cells, ROS1728 cells, NIH/3T3 cells, 4T1 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
Product Information
66068-1-Ig targets SRP9 in WB, ELISA applications and shows reactivity with human, rat, mouse samples.
Tested Reactivity | human, rat, mouse |
Cited Reactivity | human |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag17153 Product name: Recombinant human SRP9 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-86 aa of BC015094 Sequence: MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE Predict reactive species |
Full Name | signal recognition particle 9kDa |
Calculated Molecular Weight | 10 kDa |
Observed Molecular Weight | 10 kDa |
GenBank Accession Number | BC015094 |
Gene Symbol | SRP9 |
Gene ID (NCBI) | 6726 |
RRID | AB_11042618 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P49458 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Signal recognition particle 9(SRP9) is component of the signal recognition particle (SRP), which is a ribonucleoprotein complex that mediates the targeting of proteins to the rough endoplasmic reticulum (ER). SRP9 form a heterodimer with SRP14, which involves in arrest of the elongation of the nescent chains during targeting to ensure efficient translocation of the preprotein.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SRP9 antibody 66068-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
bioRxiv Variable patterns of retrotransposition in different HeLa strains provide mechanistic insights into SINE RNA mobilization processes | ||
Nucleic Acids Res Variable patterns of retrotransposition in different HeLa strains provide mechanistic insights into SINE RNA mobilization processes |