SRP9 Monoclonal antibody, PBS Only

• 

  WB analysis using 66068-1-Ig (same clone as 66068-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66068-1-Ig (SRP9 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66068-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66068-1-Ig (same clone as 66068-1-PBS)

  WB result of SRP9 antibody (66068-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SRP9 transfected HeLa cells. This data was developed using the same antibody clone with 66068-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66068-1-Ig (same clone as 66068-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66068-1-Ig (SRP9 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66068-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66068-1-Ig (same clone as 66068-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66068-1-Ig (SRP9 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66068-1-PBS in a different storage buffer formulation.

• 

  WB analysis of ROS1728 using 66068-1-Ig (same clone as 66068-1-PBS)

  ROS1728 cells were subjected to SDS PAGE followed by western blot with 66068-1-Ig (SRP9 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66068-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66068-1-Ig (same clone as 66068-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66068-1-Ig (SRP9 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66068-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SRP9 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66068-1-PBS

Clone No.1H7G10

Host / Isotype

Mouse / IgG2a

Reactivity

human, rat, mouse

Applications

WB, Indirect ELISA

Synonyms

ALURBP, SRP9

---

Product Information

66068-1-PBS targets SRP9 in WB, Indirect ELISA applications and shows reactivity with human, rat, mouse samples.

• Tested Reactivity: human, rat, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17153

  Product name: Recombinant human SRP9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-86 aa of BC015094

  Sequence: MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE

• Full Name: signal recognition particle 9kDa
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC015094
• Gene Symbol: SRP9
• Gene ID (NCBI): 6726
• RRID: AB_11042618
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49458
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Signal recognition particle 9(SRP9) is component of the signal recognition particle (SRP), which is a ribonucleoprotein complex that mediates the targeting of proteins to the rough endoplasmic reticulum (ER). SRP9 form a heterodimer with SRP14, which involves in arrest of the elongation of the nescent chains during targeting to ensure efficient translocation of the preprotein.