SSTR1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SSTR1 Polyclonal antibody (20587-1-AP)

SSTR1 Polyclonal Antibody for WB, FC (Intra), ELISA

Cat No. 20587-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), ELISA

Synonyms

somatostatin receptor 1, Somatostatin receptor type 1, SRIF 2, SRIF-2, SS 1 R

• 

  WB analysis of L02 using 20587-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 20587-1-AP (SSTR1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse small intestine using 20587-1-AP

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 20587-1-AP (SSTR1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SH-SY5Y using 20587-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 20587-1-AP (SSTR1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 20587-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20587-1-AP (SSTR1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of BxPC-3 using 20587-1-AP

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 20587-1-AP (SSTR1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of SH-SY5Y using 20587-1-AP

  1x10^6 SH-SY5Y cells were intracellularly stained with 0.8 ug SSTR1 Polyclonal antibody (20587-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.8 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SSTR1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: L02 cells, BxPC-3 cells, mouse brain tissue, mouse small intestine tissue, SH-SY5Y cells
• Positive FC (Intra) detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20587-1-AP targets SSTR1 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14287

  Product name: Recombinant human SSTR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-70 aa of BC035618

  Sequence: MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAILISFIYSVVCL

• Full Name: somatostatin receptor 1
• Calculated Molecular Weight: 391 aa, 43 kDa
• Observed Molecular Weight: 53 kDa, 63 kDa
• GenBank Accession Number: BC035618
• Gene Symbol: SSTR1
• Gene ID (NCBI): 6751
• RRID: AB_10755146
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30872
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SSTR1 Polyclonal antibody (Cat# 20587-1-AP) has 1 total citation. It was cited in Advanced Science in a 2025 study by Han Wang et al. titled "The Primary Cilia are Associated with the Axon Initial Segment in Neurons," where it was used for Western blot in human samples. The research field is neuroscience, specifically investigating the relationship between primary cilia and axon initial segments in neurons.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Adv Sci (Weinh); The Primary Cilia are Associated with the Axon Initial Segment in Neurons; Authors - Han Wang ; KD Validated