Tested Applications
Positive WB detected in | L02 cells, BxPC-3 cells, mouse brain tissue, mouse small intestine tissue, SH-SY5Y cells |
Positive FC (Intra) detected in | SH-SY5Y cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
Product Information
20587-1-AP targets SSTR1 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14287 Product name: Recombinant human SSTR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC035618 Sequence: MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAILISFIYSVVCL Predict reactive species |
Full Name | somatostatin receptor 1 |
Calculated Molecular Weight | 391 aa, 43 kDa |
Observed Molecular Weight | 53 kDa, 63 kDa |
GenBank Accession Number | BC035618 |
Gene Symbol | SSTR1 |
Gene ID (NCBI) | 6751 |
RRID | AB_10755146 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P30872 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SSTR1 antibody 20587-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |