Product Information
20587-1-PBS targets SSTR1 in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14287 Product name: Recombinant human SSTR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC035618 Sequence: MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAILISFIYSVVCL Predict reactive species |
| Full Name | somatostatin receptor 1 |
| Calculated Molecular Weight | 391 aa, 43 kDa |
| Observed Molecular Weight | 53 kDa, 63 kDa |
| GenBank Accession Number | BC035618 |
| Gene Symbol | SSTR1 |
| Gene ID (NCBI) | 6751 |
| RRID | AB_10755146 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P30872 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |











