Tested Applications
| Positive WB detected in | pig cerebellum tissue, mouse brain tissue, pig brain tissue, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60681-2-Ig targets SSTR1 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30826 Product name: Recombinant human SSTR1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 328-391 aa of BC035618 Sequence: DNFKRSFQRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTCTSRITTL Predict reactive species |
| Full Name | somatostatin receptor 1 |
| Calculated Molecular Weight | 391 aa, 43 kDa |
| Observed Molecular Weight | 53 kDa |
| GenBank Accession Number | BC035618 |
| Gene Symbol | SSTR1 |
| Gene ID (NCBI) | 6751 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P30872 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SSTR1 is a Gi/o-coupled somatostatin receptor expressed in the brain, pancreas, and gastrointestinal epithelium, where it modulates neurotransmission, hormone secretion, and cellular proliferation. Through suppression of cAMP and regulation of Ca²⁺ signaling, SSTR1 mediates key inhibitory actions of somatostatin. Its expression in neuroendocrine tumors and roles in metabolic and neurological regulation underscore its clinical and biological relevance.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SSTR1 antibody 60681-2-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





