Use Able AI chat for product recommendations

SSTR1 Monoclonal antibody

SSTR1 Monoclonal Antibody for WB, FC (Intra), ELISA

Cat No. 60681-2-Ig
Clone No.1F5E10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, FC (Intra), ELISA

somatostatin receptor 1, Somatostatin receptor type 1, SRIF 2, SRIF-2, SS 1 R

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig cerebellum tissue, mouse brain tissue, pig brain tissue, rat brain tissue
Positive FC (Intra) detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60681-2-Ig targets SSTR1 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30826

Product name: Recombinant human SSTR1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 328-391 aa of BC035618

Sequence: DNFKRSFQRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTCTSRITTL

Predict reactive species
Full Name somatostatin receptor 1
Calculated Molecular Weight 391 aa, 43 kDa
Observed Molecular Weight53 kDa
GenBank Accession NumberBC035618
Gene Symbol SSTR1
Gene ID (NCBI) 6751
RRIDAB_3743230
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP30872
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SSTR1 is a Gi/o-coupled somatostatin receptor expressed in the brain, pancreas, and gastrointestinal epithelium, where it modulates neurotransmission, hormone secretion, and cellular proliferation. Through suppression of cAMP and regulation of Ca²⁺ signaling, SSTR1 mediates key inhibitory actions of somatostatin. Its expression in neuroendocrine tumors and roles in metabolic and neurological regulation underscore its clinical and biological relevance.

Protocols

Product Specific Protocols
FC protocol for SSTR1 antibody 60681-2-IgDownload protocol
WB protocol for SSTR1 antibody 60681-2-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...