SSTR1 Monoclonal antibody, PBS Only (Detector)

SSTR1 Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 60681-2-PBS
Clone No.1F5E10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, Cytometric bead array, Indirect ELISA

somatostatin receptor 1, Somatostatin receptor type 1, SRIF 2, SRIF-2, SS 1 R

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60681-2-PBS targets SSTR1 as part of a matched antibody pair:

MP50980-1: 60681-1-PBS capture and 60681-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30826

Product name: Recombinant human SSTR1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 328-391 aa of BC035618

Sequence: DNFKRSFQRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTCTSRITTL

Predict reactive species
Full Name somatostatin receptor 1
Calculated Molecular Weight 391 aa, 43 kDa
Observed Molecular Weight53 kDa
GenBank Accession NumberBC035618
Gene Symbol SSTR1
Gene ID (NCBI) 6751
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP30872
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SSTR1 is a Gi/o-coupled somatostatin receptor expressed in the brain, pancreas, and gastrointestinal epithelium, where it modulates neurotransmission, hormone secretion, and cellular proliferation. Through suppression of cAMP and regulation of Ca²⁺ signaling, SSTR1 mediates key inhibitory actions of somatostatin. Its expression in neuroendocrine tumors and roles in metabolic and neurological regulation underscore its clinical and biological relevance.

Loading...
||
New chat

Able

正在加载,请稍候...