ST8SIA1 Polyclonal antibody

• 

  WB analysis using 24918-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24918-1-AP (ST8SIA1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 24918-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24918-1-AP (ST8SIA1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human skin using 24918-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 24918-1-AP (ST8SIA1 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human skin using 24918-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 24918-1-AP (ST8SIA1 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of mouse brain using 24918-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24918-1-AP (ST8SIA1 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

ST8SIA1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24918-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

Alpha-2,8-sialyltransferase 8A, Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase, EC:2.4.3.8, Sialyltransferase St8Sia I, SIAT8

---

Tested Applications

• Positive WB detected in: A431 cells, A375 cells, MCF-7 cells, MDA-MB-231 cells, SH-SY5Y cells, SK-N-SH cells
• Positive IHC detected in: human skin tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 7 publications below
• IHC: See 4 publications below
• IF: See 1 publications below

Product Information

24918-1-AP targets ST8SIA1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20429

  Product name: Recombinant human ST8SIA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 39-136 aa of BC126162

  Sequence: VLCWLYIFPVYRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLK

• Full Name: ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
• Calculated Molecular Weight: 356 aa, 41 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC126162
• Gene Symbol: ST8SIA1
• Gene ID (NCBI): 6489
• RRID: AB_2879796
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92185
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ST8SIA1 is a member of the ST family involved in the production of gangliosides. ST8SIA1 is strongly expressed in melanoma cell lines, adult and fetal brain, and to a lesser extent in adult and fetal lung. The abnormal expression of ST8SIA1 has been demonstrated to influence the metastasis of triple-negative breast cancer. (PMID: 34429775)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IF	Mol Oncol; Upregulation of cell surface GD3 ganglioside phenotype is associated with human melanoma brain metastasis.; Authors - Romela Irene Ramos
human	IHC	Front Pharmacol; Identifying an Immune-Related Gene ST8SIA1 as a Novel Target in Patients With Clear-Cell Renal Cell Carcinoma.; Authors - Xu Hu
human	IHC	Oncol Lett; ST8SIA1 inhibits the proliferation, migration and invasion of bladder cancer cells by blocking the JAK/STAT signaling pathway.; Authors - Shengjin Yu
mouse	WB	bioRxiv; Role of GD2 and its biosynthetic enzyme GD3 synthase in prostate cancer tumorigenesis; Authors - Aaqib M Bhat ; KO Validated
mouse	WB	Sci Rep; GD2 and its biosynthetic enzyme GD3 synthase promote tumorigenesis in prostate cancer by regulating cancer stem cell behavior; Authors - Aaqib M Bhat
mouse,human	WB	Ann Med; Overexpression of ST8Sia1 inhibits tumor progression by TGF-β1 signaling in rectal adenocarcinoma and promotes the tumoricidal effects of CD8+ T cells by granzyme B and perforin; Authors - Chang Zhang