• Featured Product
  • KD/KO Validated

STAT3 Polyclonal antibody

STAT3 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 10253-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (5)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, RIP, ELISA

Acute-phase response factor, APRF, HIES, STAT 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, A431 cells, HeLa cells, Jurkat cells, K-562 cells, MCF-7 cells, PC-12 cells, NIH/3T3 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman stomach cancer tissue, human colon cancer tissue, human cervical cancer tissue, mouse colon tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells, IFN alpha treated HeLa cells
Positive FC (Intra) detected inRamos cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10253-2-AP targets STAT3 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, pig, zebrafish, bovine, marmoset
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0360

Product name: Recombinant human STAT3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2-219 aa of BC000627

Sequence: AQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVS

Predict reactive species
Full Name signal transducer and activator of transcription 3 (acute-phase response factor)
Calculated Molecular Weight 770 aa, 88 kDa
Observed Molecular Weight 88 kDa
GenBank Accession NumberBC000627
Gene Symbol STAT3
Gene ID (NCBI) 6774
RRIDAB_2302876
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP40763
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3, synonyms: APRF, FLJ20882, MGC16063) is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT3 is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. STAT3 mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of STAT3. This antibody is a rabbit polyclonal antibody raised against residues near the N terminus of human STAT3. STAT3 exists three isoforms and the molecular weight of each isoform respectively is 83 kDa, 87 kDa and 88 kDa.

Protocols

Product Specific Protocols
FC protocol for STAT3 antibody 10253-2-APDownload protocol
IF protocol for STAT3 antibody 10253-2-APDownload protocol
IHC protocol for STAT3 antibody 10253-2-APDownload protocol
IP protocol for STAT3 antibody 10253-2-APDownload protocol
WB protocol for STAT3 antibody 10253-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cancer Cell

Targeting the immune privilege of tumor-initiating cells to enhance cancer immunotherapy

Authors - Chen Yang
mouseIHC

Nature

Divergent transcriptional regulation of astrocyte reactivity across disorders.

Authors - Joshua E Burda
mouse,humanWB

Cell Metab

Lactate modulates iron metabolism by binding soluble adenylyl cyclase

Authors - Wei Liu
mouseWB

Cell Mol Immunol

Malonate promotes CD8+ T cell memory formation via protein malonylation

Authors - Qianqian Duan
mouseWB

Brain Behav Immun

l-Cysteine suppresses hypoxia-ischemia injury in neonatal mice by reducing glial activation, promoting autophagic flux and mediating synaptic modification via H2S formation.

Authors - Danqing Xin
ratWB,IHC

Adv Sci (Weinh)

DNA Origami-Based CD44-Targeted Therapy Silences Stat3 Enhances Cartilage Regeneration and Alleviates Osteoarthritis Progression

Authors - Qi Lv

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Iram (Verified Customer) (03-23-2026)

Very good antibody

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:1000 for IB and for IHC 1:100
  • Cell Tissue Type: Colon cancer
FH

Sai Sindhura (Verified Customer) (03-23-2026)

Good antibody

  • Applications: Western Blot, Immunohistochemistry
  • Primary Antibody Dilution: 1:1000
FH

Iram (Verified Customer) (09-18-2025)

Bands are very clear band.

  • Applications: Western Blot, Immunohistochemistry
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: CRC cells
FH

Daniele (Verified Customer) (04-29-2022)

It works very well for WB, IF and IP

  • Applications: Western Blot, Immunofluorescence, Other
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: TNBC
FH

Yuan (Verified Customer) (01-23-2020)

Very good Stat3 antibody for western blot. Strong signal at 1:5000 dilution. Highly recommend.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: Hela
FH

Daniele (Verified Customer) (11-25-2019)

It works very well both in western blot and in immunoprecipitation.

  • Applications: Western Blot, Immunoprecipitation,
  • Primary Antibody Dilution: 1:1000 (western blot)
  • Cell Tissue Type: MDA MB 468 and A375
Loading...
||
New chat

Able

正在加载,请稍候...