Tested Applications
| Positive WB detected in | A549 cells, rat liver tissue, HaCaT cells, HeLa cells, MDA-MB-468 cells, SK-BR-3 cells, mouse liver tissue |
| Positive FC (Intra) detected in | 3T3-L1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
68465-1-Ig targets STEAP4 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30137 Product name: Recombinant human STEAP4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-110 aa of BC020600 Sequence: MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSGIIIIAIHREHYDFLTELTEVLNGKILVDISNNLKI Predict reactive species |
| Full Name | STEAP family member 4 |
| Calculated Molecular Weight | 52 kDa |
| Observed Molecular Weight | 52 kDa |
| GenBank Accession Number | BC020600 |
| Gene Symbol | STEAP4 |
| Gene ID (NCBI) | 79689 |
| RRID | AB_3085176 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q687X5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
STEAP4 (also called STAMP2), is a member of the STEAP family. Structurally, It is a 459 amino acid protein characterized by a molecular topology of six transmembrane domains. The cytoplasmic N-terminal domain of STEAP4 shows structural similarity with bacterial and archaeal FNO oxidoreductase and STEAP4 exhibits a strong iron reductase activity. Studies in mice and human suggest that STEAP4 maybe involved in adipocyte development and metabolism, and may contribute to the normal biology of the prostate cell, as well as prostate cancer progression.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for STEAP4 antibody 68465-1-Ig | Download protocol |
| WB protocol for STEAP4 antibody 68465-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





