STEAP4 Monoclonal antibody

STEAP4 Monoclonal Antibody for WB, FC (Intra), ELISA
Cat No. 68465-1-Ig
Clone No.2A12G6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), ELISA

2A12G6, EC:1.16.1.-, Metalloreductase STEAP4, Six-transmembrane epithelial antigen of prostate 4, STAMP2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, rat liver tissue, HaCaT cells, HeLa cells, MDA-MB-468 cells, SK-BR-3 cells, mouse liver tissue
Positive FC (Intra) detected in3T3-L1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68465-1-Ig targets STEAP4 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30137

Product name: Recombinant human STEAP4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-110 aa of BC020600

Sequence: MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSGIIIIAIHREHYDFLTELTEVLNGKILVDISNNLKI

Predict reactive species
Full Name STEAP family member 4
Calculated Molecular Weight 52 kDa
Observed Molecular Weight 52 kDa
GenBank Accession NumberBC020600
Gene Symbol STEAP4
Gene ID (NCBI) 79689
RRIDAB_3085176
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ687X5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STEAP4 (also called STAMP2), is a member of the STEAP family. Structurally, It is a 459 amino acid protein characterized by a molecular topology of six transmembrane domains. The cytoplasmic N-terminal domain of STEAP4 shows structural similarity with bacterial and archaeal FNO oxidoreductase and STEAP4 exhibits a strong iron reductase activity. Studies in mice and human suggest that STEAP4 maybe involved in adipocyte development and metabolism, and may contribute to the normal biology of the prostate cell, as well as prostate cancer progression.

Protocols

Product Specific Protocols
FC protocol for STEAP4 antibody 68465-1-IgDownload protocol
WB protocol for STEAP4 antibody 68465-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...