STK25 Recombinant monoclonal antibody

• 

  WB analysis using 86216-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86216-1-RR (STK25 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 86216-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86216-1-RR against Human STK25 were performed. The affinity constant is 4.10 nM.

STK25 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86216-1-RR

Clone No.250202A6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

EC:2.7.11.1, Serine/threonine-protein kinase 25, SOK 1, SOK1, SOK-1

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, A431 cells, K-562 cells, C6 cells, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86216-1-RR targets STK25 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag22964

  Product name: Recombinant human STK25 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 323-426 aa of BC015793

  Sequence: PTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHEQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR

• Full Name: serine/threonine kinase 25 (STE20 homolog, yeast)
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC015793
• Gene Symbol: STK25
• Gene ID (NCBI): 10494
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00506
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.