Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, Jurkat cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
85058-4-RR targets STRN in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag15984 Product name: Recombinant human STRN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 301-403 aa of BC106879 Sequence: NRSKLQDMLANLRDVDELPSLQPSVGSPSRPSSSRLPEHEINRADEVEALTFPPSSGKSFIMGADEALESELGLGELAGLTVANEADSLTYDIANNKDALRKT Predict reactive species |
| Full Name | striatin, calmodulin binding protein |
| Calculated Molecular Weight | 780 aa, 86 kDa |
| Observed Molecular Weight | 110 kDa |
| GenBank Accession Number | BC106879 |
| Gene Symbol | STRN |
| Gene ID (NCBI) | 6801 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O43815 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
STRN (Striatin), a 780-amino acid protein, was identified and cloned more than a decade ago. In adult mammals, striatin is mainly expressed in neurons of both the central and peripheral nervous systems with very high levels of expression in the striatum, hence its name. STRN-ALK fusion may be a potential therapeutic target in the aggressive forms of thyroid cancer (PMID: 24475247).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for STRN antibody 85058-4-RR | Download protocol |
| IHC protocol for STRN antibody 85058-4-RR | Download protocol |
| WB protocol for STRN antibody 85058-4-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |











