STRN Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85058-4-RR (same clone as 85058-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85058-4-RR (STRN antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85058-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 85058-4-RR (same clone as 85058-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 85058-4-RR (STRN antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85058-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 85058-4-RR (same clone as 85058-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 85058-4-RR (STRN antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85058-4-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 85058-4-RR (same clone as 85058-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using STRN antibody (85058-4-RR, Clone: 242532D8 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85058-4-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 85058-4-RR (same clone as 85058-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using STRN antibody (85058-4-RR, Clone: 242532D8 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85058-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85058-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85058-4-RR against Human STRN were performed. The affinity constant is 0.433 nM.

STRN Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 85058-4-PBS

Clone No.242532D8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

242532D8, SG2NA, Striatin

---

Product Information

85058-4-PBS targets STRN in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15984

  Product name: Recombinant human STRN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 301-403 aa of BC106879

  Sequence: NRSKLQDMLANLRDVDELPSLQPSVGSPSRPSSSRLPEHEINRADEVEALTFPPSSGKSFIMGADEALESELGLGELAGLTVANEADSLTYDIANNKDALRKT

• Full Name: striatin, calmodulin binding protein
• Calculated Molecular Weight: 780 aa, 86 kDa
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: BC106879
• Gene Symbol: STRN
• Gene ID (NCBI): 6801
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43815
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

STRN (Striatin), a 780-amino acid protein, was identified and cloned more than a decade ago. In adult mammals, striatin is mainly expressed in neurons of both the central and peripheral nervous systems with very high levels of expression in the striatum, hence its name. STRN-ALK fusion may be a potential therapeutic target in the aggressive forms of thyroid cancer (PMID: 24475247).