STT3B Monoclonal antibody, PBS Only

• 

  WB analysis using 68496-1-Ig (same clone as 68496-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68496-1-Ig (STT3B antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 68496-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68496-1-Ig (same clone as 68496-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68496-1-Ig (STT3B antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 68496-1-PBS in a different storage buffer formulation.

• 

  FC experiment of A431 using 68496-1-Ig (same clone as 68496-1-PBS)

  1x10^6 A431 cells were intracellularly stained with 0.8 ug STT3B Monoclonal antibody (68496-1-Ig, Clone:3B7A8) and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002)(red), or 0.8 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 68496-1-PBS in a different storage buffer formulation.

STT3B Monoclonal Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 68496-1-PBS

Clone No.3B7A8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

3B7A8, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B, EC:2.4.99.18, SIMP, Source of immunodominant MHC-associated peptides homolog

---

Product Information

68496-1-PBS targets STT3B in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30866

  Product name: Recombinant human STT3B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 173-225 aa of BC015880

  Sequence: APDNRETLDHKPRVTNIFPKQKYLSKKTTKRKRGYIKNKLVFKKGKKIFKKTV

• Full Name: STT3, subunit of the oligosaccharyltransferase complex, homolog B (S. cerevisiae)
• Calculated Molecular Weight: 97 kDa
• Observed Molecular Weight: 94 kDa
• GenBank Accession Number: BC015880
• Gene Symbol: STT3B
• Gene ID (NCBI): 201595
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8TCJ2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

STT3B is a component of the N-oligosaccharyl transferase (OST) enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). SST3B seems to be involved in complex substrate specificity