Product Information
68496-1-PBS targets STT3B in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30866 Product name: Recombinant human STT3B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 173-225 aa of BC015880 Sequence: APDNRETLDHKPRVTNIFPKQKYLSKKTTKRKRGYIKNKLVFKKGKKIFKKTV Predict reactive species |
Full Name | STT3, subunit of the oligosaccharyltransferase complex, homolog B (S. cerevisiae) |
Calculated Molecular Weight | 97 kDa |
Observed Molecular Weight | 94 kDa |
GenBank Accession Number | BC015880 |
Gene Symbol | STT3B |
Gene ID (NCBI) | 201595 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q8TCJ2 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
STT3B is a component of the N-oligosaccharyl transferase (OST) enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). SST3B seems to be involved in complex substrate specificity