STT3B Monoclonal antibody

STT3B Monoclonal Antibody for WB, FC (Intra), ELISA
Cat No. 68496-1-Ig
Clone No.3B7A8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, FC (Intra), ELISA

3B7A8, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B, EC:2.4.99.18, SIMP, Source of immunodominant MHC-associated peptides homolog

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells
Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68496-1-Ig targets STT3B in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30866

Product name: Recombinant human STT3B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 173-225 aa of BC015880

Sequence: APDNRETLDHKPRVTNIFPKQKYLSKKTTKRKRGYIKNKLVFKKGKKIFKKTV

Predict reactive species
Full Name STT3, subunit of the oligosaccharyltransferase complex, homolog B (S. cerevisiae)
Calculated Molecular Weight 97 kDa
Observed Molecular Weight 94 kDa
GenBank Accession NumberBC015880
Gene Symbol STT3B
Gene ID (NCBI) 201595
RRIDAB_3085207
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ8TCJ2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STT3B is a component of the N-oligosaccharyl transferase (OST) enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). SST3B seems to be involved in complex substrate specificity

Protocols

Product Specific Protocols
FC protocol for STT3B antibody 68496-1-IgDownload protocol
WB protocol for STT3B antibody 68496-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...