SUN1 Polyclonal antibody, PBS Only

• 

  WB analysis using 24568-1-AP (same clone as 24568-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24568-1-AP (SUN1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24568-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 24568-1-AP (same clone as 24568-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 24568-1-AP (SUN1 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24568-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 24568-1-AP (same clone as 24568-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 24568-1-AP (SUN1 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24568-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 24568-1-AP (same clone as 24568-1-PBS)

  IP result of anti-SUN1 (IP:24568-1-AP, 4ug; Detection:24568-1-AP 1:1000) with Jurkat cells lysate 3200ug. This data was developed using the same antibody clone with 24568-1-PBS in a different storage buffer formulation.

SUN1 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 24568-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

24568-1-PBS targets SUN1 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21117

  Product name: Recombinant human UNC84A protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 4-257 aa of BC013613

  Sequence: SRLHMYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPVFDSPRMSRRSLRLATTACTLGDGEAVGADSGTSSAVSLKNRAARTTKQRRSTNKSAFSINHVSRQVTSSGVSHGGTVSLQDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAPPGPVSRVYSRDRNQKCKSQSFKTQKKVCFPNLIFPFCKSQCLHYLSWRLKIIP

• Full Name: unc-84 homolog A (C. elegans)
• Calculated Molecular Weight: 90 kDa
• Observed Molecular Weight: 90-100 kDa
• GenBank Accession Number: BC013613
• Gene Symbol: SUN1
• Gene ID (NCBI): 23353
• RRID: AB_2879612
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94901
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.