SUN1 Polyclonal antibody

• 

  WB analysis using 24568-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24568-1-AP (SUN1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 24568-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 24568-1-AP (SUN1 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 24568-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 24568-1-AP (SUN1 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Jurkat using 24568-1-AP

  IP result of anti-SUN1 (IP:24568-1-AP, 4ug; Detection:24568-1-AP 1:1000) with Jurkat cells lysate 3200ug.

SUN1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 24568-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF, IP, ELISA

Synonyms

KIAA0810, Protein unc 84 homolog A, Sad1/unc 84 protein like 1, SUN1, unc 84 homolog A (C. elegans), UNC84A

---

Tested Applications

• Positive WB detected in: A431 cells, Jurkat cells, K-562 cells, HeLa cells
• Positive IP detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 5 publications below
• IF: See 1 publications below
• IP: See 1 publications below

Product Information

24568-1-AP targets SUN1 in WB, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21117

  Product name: Recombinant human UNC84A protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 4-257 aa of BC013613

  Sequence: SRLHMYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPVFDSPRMSRRSLRLATTACTLGDGEAVGADSGTSSAVSLKNRAARTTKQRRSTNKSAFSINHVSRQVTSSGVSHGGTVSLQDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAPPGPVSRVYSRDRNQKCKSQSFKTQKKVCFPNLIFPFCKSQCLHYLSWRLKIIP

• Full Name: unc-84 homolog A (C. elegans)
• Calculated Molecular Weight: 90 kDa
• Observed Molecular Weight: 90-100 kDa
• GenBank Accession Number: BC013613
• Gene Symbol: SUN1
• Gene ID (NCBI): 23353
• RRID: AB_2879612
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94901
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Nuclear membrane protein SUN2 promotes replication of flaviviruses through modulating cytoskeleton reorganization mediated by NS1; Authors - Yanxia Huang
human	WB	Acta Biochim Biophys Sin (Shanghai); SUN5, a testis-specific nuclear membrane protein, participates in recruitment and export of nuclear mRNA in spermatogenesis; Authors - Xiyi He ; KD Validated
mouse	WB	Int J Mol Sci; Electrical Stimulation Generates Induced Tumor-Suppressing Cells, Offering a Potential Option for Combatting Breast Cancer and Bone Metastasis; Authors - Changpeng Cui ; KD Validated
human	WB,IF,IP	Nat Struct Mol Biol; DNA double-strand break-capturing nuclear envelope tubules drive DNA repair; Authors - Mitra Shokrollahi
human	WB	Adv Sci (Weinh); Attenuated Nuclear Tension Regulates Progerin-Induced Mechanosensitive Nuclear Wrinkling and Chromatin Remodeling; Authors - Ji-Eun Park