• Featured Product
  • KD/KO Validated

SUPT16H Monoclonal antibody, PBS Only

SUPT16H Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA
Cat No. 68243-1-PBS
Clone No.1E4C4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

FACT140, FACT 140 kDa subunit, Facilitates chromatin transcription complex subunit SPT16, Chromatin-specific transcription elongation factor 140 kDa subunit, CDC68

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68243-1-PBS targets SUPT16H in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29459

Product name: Recombinant human SUPT16H protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 926-1047 aa of NM_007192

Sequence: EPEGEGSDAEEGDSESEIEDETFNPSEDDYEEEEEDSDEDYSSEAEESDYSKESLGSEEESGKDWDELEEEARKADRESRYEEEEEQSRSMSRKRKASVHSSGRGSNRGSRHSSAPPKKKRK

Predict reactive species
Full Name suppressor of Ty 16 homolog (S. cerevisiae)
Calculated Molecular Weight 120 kDa
Observed Molecular Weight135 kDa
GenBank Accession NumberNM_007192
Gene Symbol SUPT16H
Gene ID (NCBI) 11198
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9Y5B9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SUPT16H, also named as FACT140, FACTP140, SPT16 and CDC68, belongs to the peptidase M24 family and SPT16 subfamily. SUPT16H is a component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates the passage of RNA polymerase II and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes the reestablishment of the nucleosome following the passage of RNA polymerase II. The FACT complex is probably also involved in phosphorylation of 'Ser-392' of p53/TP53 via its association with CK2 (casein kinase II). It also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene.

Loading...
||
New chat Able
正在加载,请稍候...