Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

SUPT16H Monoclonal antibody

SUPT16H Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 68243-1-Ig
Clone No.1E4C4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, RIP, ELISA

FACT140, FACT 140 kDa subunit, Facilitates chromatin transcription complex subunit SPT16, Chromatin-specific transcription elongation factor 140 kDa subunit, CDC68

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, MCF-7 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, RAW 164.7 cells
Positive IHC detected inhuman colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68243-1-Ig targets SUPT16H in WB, IHC, IF/ICC, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29459

Product name: Recombinant human SUPT16H protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 926-1047 aa of NM_007192

Sequence: EPEGEGSDAEEGDSESEIEDETFNPSEDDYEEEEEDSDEDYSSEAEESDYSKESLGSEEESGKDWDELEEEARKADRESRYEEEEEQSRSMSRKRKASVHSSGRGSNRGSRHSSAPPKKKRK

Predict reactive species
Full Name suppressor of Ty 16 homolog (S. cerevisiae)
Calculated Molecular Weight 120 kDa
Observed Molecular Weight135 kDa
GenBank Accession NumberNM_007192
Gene Symbol SUPT16H
Gene ID (NCBI) 11198
RRIDAB_2935330
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9Y5B9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SUPT16H, also named as FACT140, FACTP140, SPT16 and CDC68, belongs to the peptidase M24 family and SPT16 subfamily. SUPT16H is a component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates the passage of RNA polymerase II and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes the reestablishment of the nucleosome following the passage of RNA polymerase II. The FACT complex is probably also involved in phosphorylation of 'Ser-392' of p53/TP53 via its association with CK2 (casein kinase II). It also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene.

Protocols

Product Specific Protocols
IF protocol for SUPT16H antibody 68243-1-IgDownload protocol
IHC protocol for SUPT16H antibody 68243-1-IgDownload protocol
WB protocol for SUPT16H antibody 68243-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,RIP

Mol Cell

Alu repeat-containing RNAs spatially organize actively transcribed genomic regions around nuclear speckles.

Authors - Siqi Liu
Loading...
||
New chat

Able

正在加载,请稍候...