• Featured Product
  • KD/KO Validated

SUPT5H Polyclonal antibody

SUPT5H Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16511-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

SPT5, hSPT5, DSIF p160, DSIF large subunit, DRB sensitivity-inducing factor large subunit

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells
Positive IP detected inHeLa cells
Positive IHC detected inmouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16511-1-AP targets SUPT5H in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9728

Product name: Recombinant human SUPT5H protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 807-1087 aa of BC024203

Sequence: PLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLLEA

Predict reactive species
Full Name suppressor of Ty 5 homolog (S. cerevisiae)
Calculated Molecular Weight 1087 aa, 121 kDa
Observed Molecular Weight 140-150 kDa
GenBank Accession NumberBC024203
Gene Symbol SUPT5H
Gene ID (NCBI) 6829
RRIDAB_2878268
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO00267
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SUPT5H, also named as DSIF p160, is a 1087 amino acid protein, which belongs to the SPT5 family. SUPT5H localizes in the nucleus and is ubiquitously expressed. SUPT5H is a component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates mRNA processing and transcription elongation by RNA polymerase II. SUPT5H is modified through phosphorylation and methylated, so the molecular weight of SUPT5H might be 140-150 kDa.

Protocols

Product Specific Protocols
WB protocol for SUPT5H antibody 16511-1-APDownload protocol
IHC protocol for SUPT5H antibody 16511-1-APDownload protocol
IF protocol for SUPT5H antibody 16511-1-APDownload protocol
IP protocol for SUPT5H antibody 16511-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Mol Cell

Redundant pathways for removal of defective RNA polymerase II complexes at a promoter-proximal pause checkpoint

Authors - Daniel Blears
humanWB

Mol Cell

SPT5 stabilizes RNA polymerase II, orchestrates transcription cycles, and maintains the enhancer landscape.

Authors - Shibin Hu
  • KD Validated
humanWB

Mol Cell

INTAC endonuclease and phosphatase modules differentially regulate transcription by RNA polymerase II

Authors - Shibin Hu

Mol Cell

Three-step mechanism of promoter escape by RNA polymerase II

Authors - Yumeng Zhan

Mol Cell

CDK7 kinase activity promotes RNA polymerase II promoter escape by facilitating initiation factor release

Authors - Taras Velychko

Mol Cell

The PNUTS phosphatase complex controls transcription pause release

Authors - Jessica R Kelley
Loading...