SVCT2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SVCT2 Polyclonal antibody, PBS Only (27019-1-PBS)

• 

  WB analysis using 27019-1-AP (same clone as 27019-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27019-1-AP (SVCT2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27019-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27019-1-AP (same clone as 27019-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27019-1-AP (SVCT2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27019-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27019-1-AP (same clone as 27019-1-PBS)

  Mouse brain lysates were subjected to SDS PAGE followed by western blot with 27019-1-AP (SVCT2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27019-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 27019-1-AP (same clone as 27019-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27019-1-AP (SVCT2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27019-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 27019-1-AP (same clone as 27019-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27019-1-AP (SVCT2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27019-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 27019-1-AP (same clone as 27019-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27019-1-AP (SVCT2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27019-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 27019-1-AP (same clone as 27019-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27019-1-AP (SVCT2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27019-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 27019-1-AP (same clone as 27019-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27019-1-AP (SVCT2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27019-1-PBS in a different storage buffer formulation.

SVCT2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27019-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

27019-1-PBS targets SVCT2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25504

  Product name: Recombinant human SLC23A2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-92 aa of BC013112

  Sequence: MMGIGKNTTSKSMEAGSSTEGKYEDEAKHPAFFTLPVVINGGATSSGEQDNEDTELMAIYTTENGIAEKSSLAETLDSTGSLDPQRSDMIYT

• Full Name: solute carrier family 23 (nucleobase transporters), member 2
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC013112
• Gene Symbol: SLC23A2
• Gene ID (NCBI): 9962
• RRID: AB_2918116
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UGH3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.