SVCT2 Polyclonal antibody

• 

  WB analysis using 27019-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27019-1-AP (SVCT2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27019-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27019-1-AP (SVCT2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27019-1-AP

  Mouse brain lysates were subjected to SDS PAGE followed by western blot with 27019-1-AP (SVCT2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 27019-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27019-1-AP (SVCT2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 27019-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27019-1-AP (SVCT2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 27019-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27019-1-AP (SVCT2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 27019-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27019-1-AP (SVCT2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 27019-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27019-1-AP (SVCT2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SVCT2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27019-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

ascorbate transporter, hSVCT2, KIAA0238, NBTL1, SLC23A2, SVCT2, YSPL2

---

Tested Applications

• Positive WB detected in: Caco-2 cells, Neuro-2a cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: human colon cancer tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 1 publications below

Product Information

27019-1-AP targets SVCT2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25504

  Product name: Recombinant human SLC23A2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-92 aa of BC013112

  Sequence: MMGIGKNTTSKSMEAGSSTEGKYEDEAKHPAFFTLPVVINGGATSSGEQDNEDTELMAIYTTENGIAEKSSLAETLDSTGSLDPQRSDMIYT

• Full Name: solute carrier family 23 (nucleobase transporters), member 2
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC013112
• Gene Symbol: SLC23A2
• Gene ID (NCBI): 9962
• RRID: AB_2918116
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UGH3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	J Periodontal Res; Role of sodium-dependent vitamin C transporter 2 in human periodontal ligament fibroblasts; Authors - Tomoko Kanda
mouse	WB	Adv Sci (Weinh); Vitamin C-Dependent Intergenerational Inheritance of Enhanced Endurance Performance Following Maternal Exercise; Authors - Haiwang Shi