Tested Applications
Positive IHC detected in | mouse pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse pancreas tissue |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:4000-1:16000 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
24496-1-AP targets Somatostatin (1-116aa) in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21294 Product name: Recombinant human SST protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-116 aa of BC032625 Sequence: MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC Predict reactive species |
Full Name | somatostatin |
Calculated Molecular Weight | 13 kDa |
GenBank Accession Number | BC032625 |
Gene Symbol | Somatostatin |
Gene ID (NCBI) | 6750 |
RRID | AB_2918083 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P61278 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Somatostatin is a peptide hormone that regulates the endocrine system and affects neurotransmission and cell proliferation via interaction with G protein-coupled somatostatin receptors and inhibition of the release of numerous secondary hormones. Somatostatin is a useful marker of D-cells of pancreatic islet cells. Somatostatin inhibits ins and glucagon secretion. Somatostatin has two active forms produced by alternative cleavage of a single preproprotein: one of 14 amino acids, the other of 28 amino acids. This antibody can recognize the full length and propeptide of Somatostatin.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for Somatostatin (1-116aa) antibody 24496-1-AP | Download protocol |
IF protocol for Somatostatin (1-116aa) antibody 24496-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |