Tested Applications
| Positive WB detected in | A431 cells, HepG2 cells |
| Positive IHC detected in | mouse skeletal muscle tissue, mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27524-1-AP targets Supervillin in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26196 Product name: Recombinant human Supervillin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1679-1787 aa of NM_003174 Sequence: MFLDWTELKRSNEKNPGELAQHKEDPRTDVKAYDVTRMVSMPQTTAGTILDGVNVGRGYGLVEGHDRRQFEITSVSVDVWHILEFDYSRLPKQSIGQFHEGDAYVVKWKF Predict reactive species |
| Full Name | supervillin |
| Calculated Molecular Weight | 248 kDa |
| Observed Molecular Weight | 205 kDa |
| GenBank Accession Number | NM_003174 |
| Gene Symbol | SVIL |
| Gene ID (NCBI) | 6840 |
| RRID | AB_3669607 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95425 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Supervillin (SVIL) belongs to the villin/gelsolin superfamily of actin-binding proteins involved in many cellular processes. A non-muscle-specific form of Supervillin activates androgen receptor activity. Supervillin another isoform, called Archvillin, is expressed in skeletal and cardiac muscle tissue where it plays a role in both muscle fiber structure and signaling. Mutations in Supervillin are associated with myofibrillar Myopathy10 (MFM10), which causes myopathy with myofibrillar disorganization and autophagic vacuoles(PMID: 9867483, 32779703).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Supervillin antibody 27524-1-AP | Download protocol |
| WB protocol for Supervillin antibody 27524-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







