Syntenin-1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68096-1-Ig (same clone as 68096-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68096-1-Ig (SDCBP antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68096-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U2OS using 68096-1-Ig (same clone as 68096-1-PBS)

  U2OS cells were subjected to SDS PAGE followed by western blot with 68096-1-Ig (SDCBP antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68096-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human malignant melanoma using 68096-1-Ig (same clone as 68096-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 68096-1-Ig (Syntenin-1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68096-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human malignant melanoma using 68096-1-Ig (same clone as 68096-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 68096-1-Ig (Syntenin-1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68096-1-PBS in a different storage buffer formulation.

Syntenin-1 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 68096-1-PBS

Clone No.2B1A9

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, IHC, Indirect ELISA

Synonyms

MDA 9, MDA9, Scaffold protein Pbp1, SDCBP, ST1, SYCL, Syndecan binding protein 1, Syntenin 1, TACIP18

---

Product Information

68096-1-PBS targets Syntenin-1 in WB, IHC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18078

  Product name: Recombinant human SDCBP protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 12-139 aa of BC113674

  Sequence: VDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQ

• Full Name: syndecan binding protein (syntenin)
• Calculated Molecular Weight: 298 aa, 32 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC113674
• Gene Symbol: Syntenin-1
• Gene ID (NCBI): 6386
• RRID: AB_2918833
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O00560
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Syntenin-1, also known as SDCBP (syndecan binding protein) and MDA-9 (melanoma differentiation-associated protein 9), was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. Syntenin-1 is a PDZ-domain-containing molecule that has many interaction partners, and regulates transmembrane-receptor trafficking, cell adhesion, tumor-cell metastasis and neuronal-synapse function. Syntenin-1 is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus.