Syntenin-1 Monoclonal antibody

• 

  WB analysis using 68096-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68096-1-Ig (SDCBP antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U2OS using 68096-1-Ig

  U2OS cells were subjected to SDS PAGE followed by western blot with 68096-1-Ig (SDCBP antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human malignant melanoma using 68096-1-Ig

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 68096-1-Ig (Syntenin-1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human malignant melanoma using 68096-1-Ig

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 68096-1-Ig (Syntenin-1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Syntenin-1 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 68096-1-Ig

Clone No.2B1A9

Publications(2)

Host / Isotype

Mouse / IgG1

Reactivity

Human and More (1)

Applications

WB, IHC, ELISA

Synonyms

MDA 9, MDA9, Scaffold protein Pbp1, SDCBP, ST1, SYCL, Syndecan binding protein 1, Syntenin 1, TACIP18

---

Tested Applications

• Positive WB detected in: HeLa cells, U2OS cells, HEK-293 cell, Jurkat cells
• Positive IHC detected in: human malignant melanoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

68096-1-Ig targets Syntenin-1 in WB, IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18078

  Product name: Recombinant human SDCBP protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 12-139 aa of BC113674

  Sequence: VDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQ

• Full Name: syndecan binding protein (syntenin)
• Calculated Molecular Weight: 298 aa, 32 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC113674
• Gene Symbol: Syntenin-1
• Gene ID (NCBI): 6386
• RRID: AB_2918833
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O00560
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Syntenin-1, also known as SDCBP (syndecan binding protein) and MDA-9 (melanoma differentiation-associated protein 9), was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. Syntenin-1 is a PDZ-domain-containing molecule that has many interaction partners, and regulates transmembrane-receptor trafficking, cell adhesion, tumor-cell metastasis and neuronal-synapse function. Syntenin-1 is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Respir Res; Exosomal microRNAs of tuberculous pleural effusion orchestrating TGF-β signaling mediate pleural fibrosis.; Authors - Li-Juan Jiang
human	WB	Cell Death Dis; Direct conversion of human umbilical cord mesenchymal stem cells into retinal pigment epithelial cells for treatment of retinal degeneration; Authors - Xiaoman Zhu