Syntenin-1 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 86968-1-RR (same clone as 86968-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86968-1-RR (Syntenin-1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86968-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP02969-1

  The mean Syntenin-1 concentration was determined to be 8,459.69 ng/mL in MCF-7 cell extract based on a 1.2 mg/mL extract load, 4,141.00 ng/mL in A549 cell extract based on a 1.2 mg/mL extract load, 6,144.14 ng/mL in HepG2 cell extract based on a 1.2 mg/mL extract load, 3,765.64 ng/mL in HCT 116 cell extract based on a 1.3 mg/mL extract load and 339.31 ng/mL in PC-12 cell extract based on a 1.4 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02969-1

  Sandwich ELISA standard curve of MP02969-1, Human Syntenin-1 Recombinant Matched Antibody Pair - PBS only. 86968-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag18078. 86968-1-PBS was HRP conjugated as the detection antibody. Range: 1.56-100 ng/mL

• 

  IP experiment of HeLa using 86968-1-RR (same clone as 86968-1-PBS)

  IP result of anti-Syntenin-1 (IP:86968-1-RR, 4ug; Detection:86968-1-RR 1:1000) with HeLa cells lysate 1480 ug. This data was developed using the same antibody clone with 86968-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 86968-1-RR (same clone as 86968-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 86968-1-RR (Syntenin-1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86968-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 86968-1-RR (same clone as 86968-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using Syntenin-1 antibody (86968-1-RR, Clone: 252107H1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86968-1-PBS in a different storage buffer formulation.

Syntenin-1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IP, Sandwich ELISA, Indirect ELISA

Cat No. 86968-1-PBS

Clone No.252107H1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, Sandwich ELISA, Indirect ELISA

Synonyms

SDCBP, MDA 9, MDA9, MDA-9, Melanoma differentiation-associated protein 9

---

Product Information

86968-1-PBS targets Syntenin-1 as part of a matched antibody pair:

MP02969-1: 86968-2-PBS capture and 86968-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18078

  Product name: Recombinant human SDCBP protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 12-139 aa of BC113674

  Sequence: VDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQ

• Full Name: syndecan binding protein (syntenin)
• Calculated Molecular Weight: 298 aa, 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC113674
• Gene Symbol: Syntenin-1
• Gene ID (NCBI): 6386
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00560
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Syntenin-1, also known as SDCBP (syndecan binding protein) and MDA-9 (melanoma differentiation-associated protein 9), was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. Syntenin-1 is a PDZ-domain-containing molecule that has many interaction partners, and regulates transmembrane-receptor trafficking, cell adhesion, tumor-cell metastasis and neuronal-synapse function. Syntenin-1 is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus.