Tested Applications
Positive IHC detected in | mouse brain tissue, human hypothalamus tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse brain tissue |
Positive IF/ICC detected in | PC-12 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
28599-1-AP targets TAC1/Substance P in IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag23477 Product name: Recombinant human TAC1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 20-89 aa of BC018047 Sequence: EEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDADSSIEKQVALLKALYG Predict reactive species |
Full Name | tachykinin, precursor 1 |
Calculated Molecular Weight | 129 aa, 15 kDa |
GenBank Accession Number | BC018047 |
Gene Symbol | TAC1 |
Gene ID (NCBI) | 6863 |
RRID | AB_2881178 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P20366 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TAC1, also known as Protachykinin-1, is a gene that encodes for a family of neuropeptides known as tachykinins. These peptides are characterized by their ability to rapidly stimulate contraction of intestinal muscle, hence the name "tachykinins". The TAC1 gene and its products are widely distributed in the nervous system, with α-TAC1 mRNA localized in numerous neurons of the brain. β-TAC1 and γ-TAC1 are predominantly expressed in intrinsic enteric neurons and sensory neurons. Additionally, the expression of TAC1, SP, and NKA is observed in various peripheral neurons and non-neural tissues such as the salivary gland, heart, skin, spleen, adrenal gland, and more.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for TAC1/Substance P antibody 28599-1-AP | Download protocol |
IF protocol for TAC1/Substance P antibody 28599-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |