CoraLite® Plus 488-conjugated TAC1/Substance P Polyclonal antibody

TAC1/Substance P Polyclonal Antibody for IF/ICC
Cat No. CL488-28599

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

TAC1, C-terminal-flanking peptide, Protachykinin 1, Protachykinin-1, TAC 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inPC-12 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-28599 targets TAC1/Substance P in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag23477

Product name: Recombinant human TAC1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 20-89 aa of BC018047

Sequence: EEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDADSSIEKQVALLKALYG

Predict reactive species
Full Name tachykinin, precursor 1
Calculated Molecular Weight 129 aa, 15 kDa
GenBank Accession NumberBC018047
Gene Symbol TAC1
Gene ID (NCBI) 6863
RRIDAB_3084119
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP20366
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TAC1, also known as Protachykinin-1, is a gene that encodes for a family of neuropeptides known as tachykinins. These peptides are characterized by their ability to rapidly stimulate contraction of intestinal muscle, hence the name "tachykinins". The TAC1 gene and its products are widely distributed in the nervous system, with α-TAC1 mRNA localized in numerous neurons of the brain. β-TAC1 and γ-TAC1 are predominantly expressed in intrinsic enteric neurons and sensory neurons. Additionally, the expression of TAC1, SP, and NKA is observed in various peripheral neurons and non-neural tissues such as the salivary gland, heart, skin, spleen, adrenal gland, and more.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 TAC1/Substance P antibody CL488-28599Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...