Tested Applications
| Positive WB detected in | HeLa cells, mouse testis tissue |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:100-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 8 publications below |
| IHC | See 2 publications below |
| IF | See 5 publications below |
Product Information
26250-1-AP targets TAOK1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22461 Product name: Recombinant human TAOK1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 890-1001 aa of BC133039 Sequence: MVLSNLSPEAFSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRSTSVTSQISNGSHMSYT Predict reactive species |
| Full Name | TAO kinase 1 |
| Calculated Molecular Weight | 1001 aa, 116 kDa |
| Observed Molecular Weight | 116 kDa |
| GenBank Accession Number | BC133039 |
| Gene Symbol | TAOK1 |
| Gene ID (NCBI) | 57551 |
| RRID | AB_2880446 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7L7X3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Thousand and one kinase 1 (TAOK1), also known as prostate-derived sterile 20 (Ste20)-like kinase 2, TAO1 (thousand and one amino-acid protein 1) or MARKK, is a member of the MAP3K protein kinase and belongs to the germinal-center kinase-like class of sterile 20 (Ste20)-like kinases (PMID: 29400705). TAOK1 is involved in mammalian brain development and functions as a negative regulator in IL-17-mediated signaling and inflammation (PMID: 33565190). TAOK1 has a calculated molecular mass of 116 kDa and encodes a serine/threonine protein kinase at its N terminus.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TAOK1 antibody 26250-1-AP | Download protocol |
| IHC protocol for TAOK1 antibody 26250-1-AP | Download protocol |
| WB protocol for TAOK1 antibody 26250-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Am J Hum Genet Variants in EXOSC9 Disrupt the RNA Exosome and Result in Cerebellar Atrophy with Spinal Motor Neuronopathy. | ||
Acta Neuropathol Commun A new TAO kinase inhibitor reduces tau phosphorylation at sites associated with neurodegeneration in human tauopathies. | ||
Sci Signal Neurodevelopmental disorder-associated mutations in TAOK1 reveal its function as a plasma membrane remodeling kinase | ||
Mol Cancer Ther Targeting TAO kinases using a new inhibitor compound delays mitosis and induces mitotic cell death in centrosome amplified breast cancer cells. | ||
Mol Carcinog Targeting TAOK1 with resveratrol inhibits esophageal squamous cell carcinoma growth in vitro and in vivo
| ||
J Cell Sci Rnd3 interacts with TAO kinases and contributes to mitotic cell rounding and spindle positioning. |









