Product Information
67451-1-PBS targets TAOK3 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29146 Product name: Recombinant human TAOK3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 366-430 aa of BC002756 Sequence: SMQEVMDESSSELVMMHDDESTINSSSSVVHKKDHVFIRDEAGHGDPRPEPRPTQSVQSQALHYR Predict reactive species |
Full Name | TAO kinase 3 |
Calculated Molecular Weight | 105 kDa |
Observed Molecular Weight | 100-105 kDa |
GenBank Accession Number | BC002756 |
Gene Symbol | TAOK3 |
Gene ID (NCBI) | 51347 |
RRID | AB_2882685 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q9H2K8 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
TAOK3(Serine/threonine-protein kinase TAO3) is also named as DPK, JIK, KDS, MAP3K18 and belongs to the STE Ser/Thr protein kinase family. It acts as an activator of the p38/MAPK14 stress-activated MAPK cascade. In response to DNA damage, it is involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of upstream MAP2K3 and MAP2K6 kinases. And this protein can be autophosphorylated(PMID:20949042).