TAOK3 Monoclonal antibody, PBS Only

• 

  WB analysis using 67451-1-Ig (same clone as 67451-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67451-1-Ig (TAOK3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67451-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67451-1-Ig (same clone as 67451-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67451-1-Ig (TAOK3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67451-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67451-1-Ig (same clone as 67451-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67451-1-Ig (TAOK3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67451-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67451-1-Ig (same clone as 67451-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67451-1-Ig (TAOK3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67451-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67451-1-Ig (same clone as 67451-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67451-1-Ig (TAOK3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67451-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 67451-1-Ig (same clone as 67451-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 67451-1-Ig (TAOK3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67451-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 67451-1-Ig (same clone as 67451-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 67451-1-Ig (TAOK3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67451-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 67451-1-Ig (same clone as 67451-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 67451-1-Ig (TAOK3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67451-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human prostate cancer using 67451-1-Ig (same clone as 67451-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human prostate cancer tissue using TAOK3 antibody (67451-1-Ig, Clone: 1A5A9 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67451-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human prostate cancer using 67451-1-Ig (same clone as 67451-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human prostate cancer tissue using TAOK3 antibody (67451-1-Ig, Clone: 1A5A9 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67451-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67451-1-Ig (same clone as 67451-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using TAOK3 antibody (67451-1-Ig, Clone: 1A5A9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 67451-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TAOK3 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 67451-1-PBS

Clone No.1A5A9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

JIK, 1A5A9, CTCL-associated antigen HD-CL-09, Cutaneous T-cell lymphoma-associated antigen HD-CL-09, Dendritic cell-derived protein kinase

---

Product Information

67451-1-PBS targets TAOK3 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29146

  Product name: Recombinant human TAOK3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 366-430 aa of BC002756

  Sequence: SMQEVMDESSSELVMMHDDESTINSSSSVVHKKDHVFIRDEAGHGDPRPEPRPTQSVQSQALHYR

• Full Name: TAO kinase 3
• Calculated Molecular Weight: 105 kDa
• Observed Molecular Weight: 100-105 kDa
• GenBank Accession Number: BC002756
• Gene Symbol: TAOK3
• Gene ID (NCBI): 51347
• RRID: AB_2882685
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H2K8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TAOK3(Serine/threonine-protein kinase TAO3) is also named as DPK, JIK, KDS, MAP3K18 and belongs to the STE Ser/Thr protein kinase family. It acts as an activator of the p38/MAPK14 stress-activated MAPK cascade. In response to DNA damage, it is involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of upstream MAP2K3 and MAP2K6 kinases. And this protein can be autophosphorylated(PMID:20949042).