Tested Applications
Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells, A549 cells, LNCaP cells, K-562 cells |
Positive IHC detected in | human prostate cancer tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | human prostate cancer tissue |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
IHC | See 1 publications below |
CoIP | See 1 publications below |
Product Information
67451-1-Ig targets TAOK3 in WB, IHC, IF/ICC, IF-P, CoIP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29146 Product name: Recombinant human TAOK3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 366-430 aa of BC002756 Sequence: SMQEVMDESSSELVMMHDDESTINSSSSVVHKKDHVFIRDEAGHGDPRPEPRPTQSVQSQALHYR Predict reactive species |
Full Name | TAO kinase 3 |
Calculated Molecular Weight | 105 kDa |
Observed Molecular Weight | 100-105 kDa |
GenBank Accession Number | BC002756 |
Gene Symbol | TAOK3 |
Gene ID (NCBI) | 51347 |
RRID | AB_2882685 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q9H2K8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TAOK3(Serine/threonine-protein kinase TAO3) is also named as DPK, JIK, KDS, MAP3K18 and belongs to the STE Ser/Thr protein kinase family. It acts as an activator of the p38/MAPK14 stress-activated MAPK cascade. In response to DNA damage, it is involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of upstream MAP2K3 and MAP2K6 kinases. And this protein can be autophosphorylated(PMID:20949042).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TAOK3 antibody 67451-1-Ig | Download protocol |
IHC protocol for TAOK3 antibody 67451-1-Ig | Download protocol |
IF protocol for TAOK3 antibody 67451-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |