Tested Applications
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IF | See 2 publications below |
Product Information
CL594-66564 targets TBR1 in IF-P applications and shows reactivity with Human, rat, mouse, pig samples.
| Tested Reactivity | Human, rat, mouse, pig |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15262 Product name: Recombinant human TBR1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-196 aa of BC104844 Sequence: MQLEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFDGSAADRYLLSQSSQPQSAATAPSAMFPYPGQHGPAHPAFSIGSPSRYMAHHPVITNGAYNSLLSNSSPQGYPTAGYPYPQQYGHSYQGAPFYQFSSTQ Predict reactive species |
| Full Name | T-box, brain, 1 |
| Calculated Molecular Weight | 682 aa, 74 kDa |
| GenBank Accession Number | BC104844 |
| Gene Symbol | TBR1 |
| Gene ID (NCBI) | 10716 |
| RRID | AB_2883604 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q16650 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
TBR1, also named as T-box brain protein 1, is a 682 amino acid protein, which contains one T-box DNA-binding domain and localizes in the nucleus. TBR1 is expressed in the brain and as a transcriptional regulator is involved in developmental processes. TBR1 is required for normal brain development. The antibody is conjugated with CL594, Ex/Em 593 nm/614 nm.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL594 TBR1 antibody CL594-66564 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun CBP-HSF2 structural and functional interplay in Rubinstein-Taybi neurodevelopmental disorder | ||
Cell Stress Chaperones HDAC1 is involved in the destabilization of the HSF2 protein under non-stress and stress conditions |



