Tested Applications
| Positive WB detected in | Caco-2 cells, K-562 cells |
| Positive IP detected in | mouse lung tissue |
| Positive IHC detected in | human testis tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse skeletal muscle tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22337-1-AP targets TCF4/ITF2 in WB, IHC, IF-P, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, chicken, bovine, drosophila |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17813 Product name: Recombinant human TCF4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 407-560 aa of BC125084 Sequence: PSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITRSRSSNNDDEDLTPE Predict reactive species |
| Full Name | transcription factor 4 |
| Calculated Molecular Weight | 671 aa, 72 kDa |
| Observed Molecular Weight | 72 kDa |
| GenBank Accession Number | BC125084 |
| Gene Symbol | TCF4 |
| Gene ID (NCBI) | 6925 |
| RRID | AB_2879076 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | P15884 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Transcription factor 4 (TCF4), also known as SEF2, ITF2, E2-2, and ME2, binds to the immunoglobulin enchancer Mu-E5/KE5-motif. Involved in the initiation of neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3'). Binds to the E-box present in the somatostatin receptor 2 initiator element (SSTR2-INR) to activate transcription By similarity. Human TCF4 mRNA expression is particularly high in the brain. Usage of numerous 5' exons of the human TCF4 gene potentially yields in TCF4 protein isoforms with 18 different N-termini. In addition, the diversity of isoforms is increased by alternative splicing of several internal exons. Some isoforms contain a bipartite nuclear localization signal and are exclusively nuclear, whereas distribution of other isoforms relies on heterodimerization partners. Preferentially binds to either 5'-ACANNTGT-3' or 5'-CCANNTGG-3'.TCF4 has several splicing isoforms that are expressed differentially in tissues and during cancer progression(15547706, 12796377). The scopel of molecular weight of several isoforms is about 60-90 kDa (21789225).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TCF4/ITF2 antibody 22337-1-AP | Download protocol |
| IHC protocol for TCF4/ITF2 antibody 22337-1-AP | Download protocol |
| IP protocol for TCF4/ITF2 antibody 22337-1-AP | Download protocol |
| WB protocol for TCF4/ITF2 antibody 22337-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TCF4/ITF2 Polyclonal antibody (catalog number 22337-1-AP) has 92 citations. These appear in journals including Nature, Science, Signal Transduction and Targeted Therapy, Nature Communications, Cell Reports, Advanced Science, Cell Death & Disease, Journal of Experimental & Clinical Cancer Research, Oncogene, and iScience, among others. Research fields span oncology (colorectal, pancreatic, lung, breast, prostate, and liver cancers), Wnt/β-catenin signaling, neuroscience, immunology, cardiology, and developmental biology, with applications mainly in Western blot, IHC, IF, ChIP, and IP.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Serine/threonine/tyrosine kinase 1 drives pancreatic carcinogenesis via GSK3β sequestration-mediated Wnt/β-catenin pathway hyperactivation. | ||
Signal Transduct Target Ther B-lymphoid tyrosine kinase-mediated FAM83A phosphorylation elevates pancreatic tumorigenesis through interacting with β-catenin | ||
Nature Thalamocortical transcriptional gates coordinate memory stabilization.
| ||
Mol Cancer The miR-23a/27a/24 - 2 cluster drives immune evasion and resistance to PD-1/PD-L1 blockade in non-small cell lung cancer |
Reviews
What customers say
The single review for 22337-1-AP is a 5-star rating for Western Blot. The user tested it on B cells at a 1:1000 dilution and reported clear results, noting the antibody presents as two bands that changed as expected when confirming omics results following treatment. The blots were imaged using a blotting accelerator, and overall the reviewer found the performance reliable and consistent with their expected outcomes.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Annabel (Verified Customer) (12-23-2025) | Presents as two bands, but both of these change as expected. We are confirming omics results with treatment so the results are as expected and the western blots very clear (imaged using blotting accelerator).
 |
