• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated TCF4 Polyclonal antibody

TCF4 Polyclonal Antibody for IF-P
Cat No. CL488-22337

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF-P

bHLHb19, E2 2, ITF 2, ITF2, PTHS, SEF 2, SEF2, SEF2 1, SEF2 1A, SEF2 1B, SL3 3 enhancer factor 2, TCF 4, TCF4, transcription factor 4

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse skeletal muscle tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-22337 targets TCF4 in IF-P applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17813

Product name: Recombinant human TCF4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 407-560 aa of BC125084

Sequence: PSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITRSRSSNNDDEDLTPE

Predict reactive species
Full Name transcription factor 4
Calculated Molecular Weight 671 aa, 72 kDa
Observed Molecular Weight 72 kDa
GenBank Accession NumberBC125084
Gene Symbol TCF4
Gene ID (NCBI) 6925
RRIDAB_3672742
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP15884
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Transcription factor 4 (TCF4), also known as SEF2, ITF2, E2-2, and ME2, binds to the immunoglobulin enchancer Mu-E5/KE5-motif. Involved in the initiation of neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3'). Binds to the E-box present in the somatostatin receptor 2 initiator element (SSTR2-INR) to activate transcription By similarity. Human TCF4 mRNA expression is particularly high in the brain. Usage of numerous 5' exons of the human TCF4 gene potentially yields in TCF4 protein isoforms with 18 different N-termini. In addition, the diversity of isoforms is increased by alternative splicing of several internal exons. Some isoforms contain a bipartite nuclear localization signal and are exclusively nuclear, whereas distribution of other isoforms relies on heterodimerization partners. Preferentially binds to either 5'-ACANNTGT-3' or 5'-CCANNTGG-3'.TCF4 has several splicing isoforms that are expressed differentially in tissues and during cancer progression(15547706, 12796377). The scopel of molecular weight of several isoforms is about 60-90 kDa (21789225).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 TCF4 antibody CL488-22337Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...