TEAD2 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse colon using 21159-1-AP (same clone as 21159-1-PBS)

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 21159-1-AP (TEAD2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21159-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 21159-1-AP (same clone as 21159-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 21159-1-AP (TEAD2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21159-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TEAD2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21159-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

21159-1-PBS targets TEAD2 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14074

  Product name: Recombinant human TEAD2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 121-251 aa of BC051301

  Sequence: DQVSKDKAFQTMATMSSAQLISAPSLQAKLGPTGPQVVQASELFQFWSGGSGPPWNVPDVKPFSQTPFTLSLTPPSTDLPGYEPPQALSPLPPPTPSPPAWQARGLGTARLQLVEFSAFVEPPDAVDSYQR

• Full Name: TEA domain family member 2
• Calculated Molecular Weight: 447 aa, 49 kDa
• Observed Molecular Weight: 55-65 kDa
• GenBank Accession Number: BC051301
• Gene Symbol: TEAD2
• Gene ID (NCBI): 8463
• RRID: AB_2861186
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15562
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TEAD2 belongs to a protein family that shares the TEA/ATTS domain. It acts as a transcriptional factor by cooperatively binding to the GT-IIC and Sph(I 1 II) enhansons in the simian virus 40 (SV40) enhancer. Also, it can modulate SV40 late transcription together with a large T antigen. The transcriptional activity of TEAD2 required several regions of the proteins, TBP-associated factors, and limiting transcriptional intermediary factors. TEAD2 also performs an essential role in the Hippo signaling pathway. TEAD2 regulates gene expression of YAP1 and WWTR1/TAZ, thus mediating cell proliferation, migration, and epithelial-mesenchymal transition induction. TEAD2 is strongly expressed in the human ovarian carcinoma cell line.