CoraLite® Plus 750-conjugated TFPI2 Recombinant monoclonal antibody

TFPI2 Uni-rAb® Recombinant Antibody for WB
Cat No. CL750-83279
Clone No.230135E3

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB

FLJ21164, Placental protein 5, PP5, REF1, TFPI 2, TFPI2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman placenta tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-83279 targets TFPI2 in WB applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag33467

Product name: Recombinant human TFPI2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 71-190 aa of NM_001271003.1

Sequence: GNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTG

Predict reactive species
Full Name tissue factor pathway inhibitor 2
Calculated Molecular Weight27 kDa
Observed Molecular Weight26-29 kDa
GenBank Accession NumberNM_001271003.1
Gene Symbol TFPI2
Gene ID (NCBI) 7980
RRIDAB_3673779
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP48307
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TFPI2 (tissue factor pathway inhibitor 2), also known as PP5. It is expected to be located in extracellular space, and the protein is enriched in the placenta. This gene encodes a member of the Kunitz-type serine proteinase inhibitor family. The protein can inhibit a variety of serine proteases including factor VIIa/tissue factor, factor Xa, plasmin, trypsin, chymotrypsin and plasma kallikrein. This gene has been identified as a tumor suppressor gene in several types of cancer. The molecular weight of TFPI2 is 27 kDa, and it can recognize the band of 36 kDa (PMID: 21421890).

Protocols

Product Specific Protocols
WB protocol for CL Plus 750 TFPI2 antibody CL750-83279Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...