Tested Applications
| Positive WB detected in | human placenta tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL750-83279 targets TFPI2 in WB applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag33467 Product name: Recombinant human TFPI2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 71-190 aa of NM_001271003.1 Sequence: GNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTG Predict reactive species |
| Full Name | tissue factor pathway inhibitor 2 |
| Calculated Molecular Weight | 27 kDa |
| Observed Molecular Weight | 26-29 kDa |
| GenBank Accession Number | NM_001271003.1 |
| Gene Symbol | TFPI2 |
| Gene ID (NCBI) | 7980 |
| RRID | AB_3673779 |
| Conjugate | CoraLite® Plus 750 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 755 nm / 780 nm |
| Excitation Laser | Red Laser (633 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P48307 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
TFPI2 (tissue factor pathway inhibitor 2), also known as PP5. It is expected to be located in extracellular space, and the protein is enriched in the placenta. This gene encodes a member of the Kunitz-type serine proteinase inhibitor family. The protein can inhibit a variety of serine proteases including factor VIIa/tissue factor, factor Xa, plasmin, trypsin, chymotrypsin and plasma kallikrein. This gene has been identified as a tumor suppressor gene in several types of cancer. The molecular weight of TFPI2 is 27 kDa, and it can recognize the band of 36 kDa (PMID: 21421890).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CL Plus 750 TFPI2 antibody CL750-83279 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

