HIC5 Recombinant monoclonal antibody

HIC5 Uni-rAb® Recombinant Antibody for WB, ELISA

Cat No. 85859-5-RR
Clone No.250139E8

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

Androgen receptor-associated protein of 55 kDa, ARA55, Hic-5, Hydrogen peroxide-inducible clone 5 protein, TGFB1I1

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, rat colon tissue, SKOV-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85859-5-RR targets HIC5 in WB, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0868

Product name: Recombinant human TGFB1I1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-230 aa of BC001830

Sequence: MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGRAW

Predict reactive species
Full Name transforming growth factor beta 1 induced transcript 1
Calculated Molecular Weight 48 kDa
Observed Molecular Weight48-50 kDa
GenBank Accession NumberBC001830
Gene Symbol HIC5
Gene ID (NCBI) 7041
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO43294
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HIC5 (Hydrogen Peroxide-Inducible Clone 5), also known as TGFB1I1, ARA55, or TSC-5. It was first identified in 1994 as a gene induced by transforming growth factor-β (TGF-β) or hydrogen peroxide (PMID: 36222304). HIC5 is a member of the Paxillin protein family and functions as a molecular adapter, delivering signals when the cellular adhesion environment changes. Given its role in cancer and fibrotic diseases, HIC5 is a potential therapeutic target. For example, targeting HIC5 or the GR tau2 region could modulate the set of genes regulated by GR, providing opportunities for intervention (PMID: 24591583).

Protocols

Product Specific Protocols
WB protocol for HIC5 antibody 85859-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...