TGM2 Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of HeLa using 68006-1-Ig (same clone as 68006-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 68006-1-Ig (TGM2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68006-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HUVEC using 68006-1-Ig (same clone as 68006-1-PBS)

  HUVEC cells were subjected to SDS PAGE followed by western blot with 68006-1-Ig (TGM2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68006-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 68006-1-Ig (same clone as 68006-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 68006-1-Ig (TGM2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68006-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 68006-1-Ig (same clone as 68006-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 68006-1-Ig (TGM2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68006-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 68006-1-Ig (same clone as 68006-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 68006-1-Ig (TGM2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68006-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 68006-1-Ig (same clone as 68006-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 68006-1-Ig (TGM2 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68006-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 68006-1-Ig (same clone as 68006-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using TGM2 antibody (68006-1-Ig, Clone: 2D4C11 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). This data was developed using the same antibody clone with 68006-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 68006-1-Ig (same clone as 68006-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human TGM2 (68006-1-Ig, Clone:2D4C11) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2a Isotype Control (C1.18.4) (65208-1-Ig, Clone: C1.18.4) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 68006-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP51456-1

  Cytometric bead array sample test of MP51456-1, TGM2 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68006-1-PBS. Detection antibody: 68006-2-PBS.

• 

  Cytometric bead array standard curve of MP51456-1

  Cytometric bead array standard curve of MP51456-1, TGM2 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68006-1-PBS. Detection antibody: 68006-2-PBS. Standard:Ag7462. Range: 3.125-400 ng/mL.

TGM2 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 68006-1-PBS

Clone No.2D4C11

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

2D4C11, Erythrocyte transglutaminase, TG(C), TG2, TGase 2

---

Product Information

68006-1-PBS targets TGM2 as part of a matched antibody pair:

MP51456-1: 68006-1-PBS capture and 68006-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7462

  Product name: Recombinant human TGM2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-349 aa of BC003551

  Sequence: MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLEASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPWNFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGRWDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQP

• Full Name: transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase)
• Calculated Molecular Weight: 77 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC003551
• Gene Symbol: TGM2
• Gene ID (NCBI): 7052
• ENSEMBL Gene ID: ENSG00000198959
• RRID: AB_2918753
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P21980
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Transglutaminase 2 (TGM2) is a ubiquitous and multifunctional calcium-dependent enzyme belonging to the transglutaminase family. It is best known for its canonical activity of catalyzing the cross-linking of proteins by forming stable ε-(γ-glutamyl)lysine isopeptide bonds, which contributes to extracellular matrix stabilization and wound healing. Beyond this, TGM2 exhibits GTPase activity, allowing it to function as a signaling G-protein in intracellular processes. It is implicated in a wide range of physiological functions, including cell adhesion, proliferation, and apoptosis, as well as pathological conditions such as celiac disease, fibrosis, neurodegenerative disorders, and cancer metastasis, where its dysregulated expression often contributes to disease progression.