TGM2 Monoclonal antibody

• 

  WB analysis of HeLa using 68006-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 68006-1-Ig (TGM2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HUVEC using 68006-1-Ig

  HUVEC cells were subjected to SDS PAGE followed by western blot with 68006-1-Ig (TGM2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 68006-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 68006-1-Ig (TGM2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 68006-1-Ig

  K-562 cells were subjected to SDS PAGE followed by western blot with 68006-1-Ig (TGM2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 68006-1-Ig

  human placenta tissue were subjected to SDS PAGE followed by western blot with 68006-1-Ig (TGM2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 68006-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 68006-1-Ig (TGM2 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 68006-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using TGM2 antibody (68006-1-Ig, Clone: 2D4C11 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002).

• 

  FC experiment of HeLa using 68006-1-Ig

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human TGM2 (68006-1-Ig, Clone:2D4C11) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2a Isotype Control (C1.18.4) (65208-1-Ig, Clone: C1.18.4) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

TGM2 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 68006-1-Ig

Clone No.2D4C11

Publications(5)

Host / Isotype

Mouse / IgG2a

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, FC (Intra), CoIP, ELISA

Synonyms

2D4C11, Erythrocyte transglutaminase, TG(C), TG2, TGase 2

---

Tested Applications

• Positive WB detected in: HeLa cells, human placenta tissue, HUVEC cells, HepG2 cells, K-562 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:2000-1:8000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 3 publications below
• IHC: See 2 publications below
• IF: See 2 publications below
• CoIP: See 1 publications below

Product Information

68006-1-Ig targets TGM2 in WB, IHC, IF/ICC, FC (Intra), CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, hamster
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7462

  Product name: Recombinant human TGM2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-349 aa of BC003551

  Sequence: MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLEASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPWNFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGRWDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQP

• Full Name: transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase)
• Calculated Molecular Weight: 77 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC003551
• Gene Symbol: TGM2
• Gene ID (NCBI): 7052
• ENSEMBL Gene ID: ENSG00000198959
• RRID: AB_2918753
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P21980
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transglutaminase 2 (TGM2) is a ubiquitous and multifunctional calcium-dependent enzyme belonging to the transglutaminase family. It is best known for its canonical activity of catalyzing the cross-linking of proteins by forming stable ε-(γ-glutamyl)lysine isopeptide bonds, which contributes to extracellular matrix stabilization and wound healing. Beyond this, TGM2 exhibits GTPase activity, allowing it to function as a signaling G-protein in intracellular processes. It is implicated in a wide range of physiological functions, including cell adhesion, proliferation, and apoptosis, as well as pathological conditions such as celiac disease, fibrosis, neurodegenerative disorders, and cancer metastasis, where its dysregulated expression often contributes to disease progression.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Biomaterials; Tumor-specific nitric oxide generator to amplify peroxynitrite based on highly penetrable nanoparticles for metastasis inhibition and enhanced cancer therapy.; Authors - Menghao Shi
mouse	WB,IHC	Transl Res; Counteracting TGM2 by a Fibroin peptide ameliorated Adriamycin-induced nephropathy via regulation of lipid metabolism through PANX1-PPAR α/PANK1 pathway; Authors - Shan-Shan Li
		F1000Res; A guide to selecting high-performing antibodies for Protein-glutamine gamma-glutamyltransferase 2 (TGM2) for use in western blot, immunoprecipitation and immunofluorescence; Authors - Riham Ayoubi
hamster	WB	ACS Synth Biol; Overexpression of Tgm2 in Chinese Hamster Ovary Cells Enhances Recombinant Monoclonal Antibody Expression and Promotes Cell Proliferation through Reduction of Apoptosis; Authors - Hui-Jie Zhang ; KD Validated
human	WB,IHC,IF,CoIP	Discov Oncol; Transglutaminase 2 nuclear localization enhances glioblastoma radiation resistance; Authors - Cuiping Sun ; KD Validated