• Featured Product
  • KD/KO Validated

TIA1 Polyclonal antibody

TIA1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 12133-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, RIP, ELISA

Cytotoxic granule associated RNA binding protein TIA1, Nucleolysin TIA-1 isoform p40, p40 TIA 1, p40-TIA-1, RNA binding protein TIA 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCOLO 320 cells, Jurkat cells, mouse spleen tissue, mouse thymus tissue, Raji cells, Caco-2 cells, Daudi cells
Positive IP detected inJurkat cells
Positive IHC detected inhuman lymphoma tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inL02 cells, HepG2 cells, HeLa cells, sodium arsenite treated HeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12133-2-AP targets TIA1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2778

Product name: Recombinant human TIA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-214 aa of BC015944

Sequence: MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYECRCIGEEKEMWNFGEKYARF

Predict reactive species
Full Name TIA1 cytotoxic granule-associated RNA binding protein
Calculated Molecular Weight 214 aa, 24 kDa, 43 kDa
Observed Molecular Weight ~40 kDa
GenBank Accession NumberBC015944
Gene Symbol TIA1
Gene ID (NCBI) 7072
RRIDAB_2201427
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP31483
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TIA1, also named as p40-TIA-1, is involved in alternative pre-RNA splicing and regulation of mRNA translation by binding to AU-rich elements (AREs) located in mRNA 3' untranslated regions (3' UTRs). It possesses nucleolytic activity against cytotoxic lymphocyte target cells. TIA1 may be involved in apoptosis. Two isoforms of this protein exist - 41kDa and 42kDa. one of these was a missense variant (P362L) in TIA1. Similar to the ALS-related disease proteins TDP-43, hnRNPA1, and FUS, TIA1 is an RNA-binding protein containing a prionlike LCD and assembles into membrane-less organelles, including SGs. Postmortem neuropathology of five TIA1mutations carriers showed a consistent pathological signature with numerous round, hyaline, TAR DNA-binding protein 43 (TDP-43)-positive inclusions.TIA1mutations significantly increased the propensity of TIA1 protein to undergo phase transition. In live cells,TIA1mutations delayed stress granule (SG) disassembly and promoted the accumulation of non-dynamic SGs that harbored TDP-43. Moreover, TDP-43 in SGs became less mobile and insoluble.

Protocols

Product Specific Protocols
FC protocol for TIA1 antibody 12133-2-APDownload protocol
IF protocol for TIA1 antibody 12133-2-APDownload protocol
IHC protocol for TIA1 antibody 12133-2-APDownload protocol
IP protocol for TIA1 antibody 12133-2-APDownload protocol
WB protocol for TIA1 antibody 12133-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell

In vivo structural characterization of the SARS-CoV-2 RNA genome identifies host proteins vulnerable to repurposed drugs.

Authors - Lei Sun
  • KD Validated
humanRIP

Cell Res

Predicting dynamic cellular protein-RNA interactions by deep learning using in vivo RNA structures.

Authors - Lei Sun
mouseWB

Nat Struct Mol Biol

TDP-43 aggregation induced by oxidative stress causes global mitochondrial imbalance in ALS.

Authors - Xinxin Zuo
humanIHC,IF

Neuron

TIA1 Mutations in Amyotrophic Lateral Sclerosis and Frontotemporal Dementia Promote Phase Separation and Alter Stress Granule Dynamics.

Authors - Ian R Mackenzie
mouseWB

Nat Commun

Cellular stress alters 3'UTR landscape through alternative polyadenylation and isoform-specific degradation.

Authors - Dinghai Zheng
mouseWB

Brain

Defective cyclophilin A induces TDP-43 proteinopathy: implications for amyotrophic lateral sclerosis and frontotemporal dementia

Authors - Laura Pasetto

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

haibo (Verified Customer) (09-28-2020)

Western blotting was good. But can not see clear granule signal even after treatment by IF. The cells used were fibroblasts.

  • Applications: Western Blot, Immunofluorescence
FH

Manohar (Verified Customer) (09-23-2020)

Used 1% Milk for blocking

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293
FH

Joshua (Verified Customer) (12-28-2019)

PANC1 cells fixed in 4% paraformaldehyde and stained overnight at 4C. Bright staining, mix of nuclear and stress granule localization as expected.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Human pancreatic adenocarcinoma
TIA1 Antibody Immunofluorescence, validation (1:500 dilution) in Human pancreatic adenocarcinoma (Cat no:12133-2-AP)
FH

Joshua (Verified Customer) (12-12-2018)

We found acetone fixation (20 min in 100% acetone at -20C) worked better than paraformaldehyde.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: IMR90 Human Lung Fibroblasts
TIA1 Antibody Immunofluorescence, validation (1:500 dilution) in IMR90 Human Lung Fibroblasts (Cat no:12133-2-AP)
Loading...
||
New chat

Able

正在加载,请稍候...