TIMM9 Polyclonal antibody

• 

  WB analysis using 11479-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11479-1-AP (TIMM9 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 11479-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11479-1-AP (TIMM9 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 11479-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 11479-1-AP (TIMM9 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 11479-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 11479-1-AP (TIMM9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 11479-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 11479-1-AP (TIMM9 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TIMM9 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11479-1-AP

Publications(5)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

TIMM9A, TIM9A, TIM9

---

Tested Applications

• Positive WB detected in: A549 cells, mouse liver tissue, HepG2 cells
• Positive IHC detected in: human liver tissue, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below

Product Information

11479-1-AP targets TIMM9 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2050

  Product name: Recombinant human TIMM9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-89 aa of BC020213

  Sequence: MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR

• Full Name: translocase of inner mitochondrial membrane 9 homolog (yeast)
• Calculated Molecular Weight: 89 aa, 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC020213
• Gene Symbol: TIMM9
• Gene ID (NCBI): 26520
• RRID: AB_2204698
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5J7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Stem Cell; Disrupting Mitochondrial Copper Distribution Inhibits Leukemic Stem Cell Self-Renewal.; Authors - Rashim Pal Singh
human	WB	Aging Cell; Dependence of PINK1 accumulation on mitochondrial redox system.; Authors - Feng Gao
human	WB	J Biol Chem; Forkhead Box O3A (FOXO3) and the Mitochondrial Disulfide Relay Carrier (CHCHD4) Regulate p53 Protein Nuclear Activity in Response to Exercise.; Authors - Jie Zhuang
human	WB	PLoS One; Megakaryocytic Differentiation of K562 Cells Induced by PMA Reduced the Activity of Respiratory Chain Complex IV.; Authors - Rui Huang
human	WB	FEBS Lett; TIM29 is a subunit of the human carrier translocase required for protein transport.; Authors - Sylvie Callegari

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Angela (Verified Customer) (12-27-2024)

very good antibody !

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: heart tissue

TIMM9 Antibody Western Blot validation (1:1000 dilution) in heart tissue (Cat no:11479-1-AP)