Tested Applications
Positive WB detected in | A549 cells, mouse liver tissue, HepG2 cells |
Positive IHC detected in | human liver tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 5 publications below |
Product Information
11479-1-AP targets TIMM9 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2050 Product name: Recombinant human TIMM9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-89 aa of BC020213 Sequence: MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR Predict reactive species |
Full Name | translocase of inner mitochondrial membrane 9 homolog (yeast) |
Calculated Molecular Weight | 89 aa, 10 kDa |
Observed Molecular Weight | 10 kDa |
GenBank Accession Number | BC020213 |
Gene Symbol | TIMM9 |
Gene ID (NCBI) | 26520 |
RRID | AB_2204698 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y5J7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TIMM9 antibody 11479-1-AP | Download protocol |
IHC protocol for TIMM9 antibody 11479-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Stem Cell Disrupting Mitochondrial Copper Distribution Inhibits Leukemic Stem Cell Self-Renewal. | ||
J Biol Chem Forkhead Box O3A (FOXO3) and the Mitochondrial Disulfide Relay Carrier (CHCHD4) Regulate p53 Protein Nuclear Activity in Response to Exercise. | ||
PLoS One Megakaryocytic Differentiation of K562 Cells Induced by PMA Reduced the Activity of Respiratory Chain Complex IV. | ||
FEBS Lett TIM29 is a subunit of the human carrier translocase required for protein transport. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Angela (Verified Customer) (12-27-2024) | very good antibody !
![]() |