Tested Applications
| Positive WB detected in | A549 cells, mouse liver tissue, HepG2 cells |
| Positive IHC detected in | human liver tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11479-1-AP targets TIMM9 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2050 Product name: Recombinant human TIMM9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-89 aa of BC020213 Sequence: MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR Predict reactive species |
| Full Name | translocase of inner mitochondrial membrane 9 homolog (yeast) |
| Calculated Molecular Weight | 89 aa, 10 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC020213 |
| Gene Symbol | TIMM9 |
| Gene ID (NCBI) | 26520 |
| RRID | AB_2204698 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y5J7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TIMM9 antibody 11479-1-AP | Download protocol |
| IHC protocol for TIMM9 antibody 11479-1-AP | Download protocol |
| WB protocol for TIMM9 antibody 11479-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TIMM9 Polyclonal antibody (Cat# 11479-1-AP) has 6 citations, published in Cell Stem Cell, Molecular Cell, Aging Cell, Journal of Biological Chemistry, FEBS Letters, and PLoS One. Research fields span mitochondrial copper distribution in leukemic stem cells, mitochondrial iron uptake/Fe-S biogenesis, PINK1 redox regulation, FOXO3/p53 nuclear activity, the TIM29 carrier translocase, and megakaryocytic differentiation/respiratory chain function.
| Species | Application | Title |
|---|---|---|
Cell Stem Cell Disrupting Mitochondrial Copper Distribution Inhibits Leukemic Stem Cell Self-Renewal. | ||
Mol Cell The TIM22 carrier translocase supports cell proliferation by facilitating mitochondrial iron uptake for Fe-S biogenesis. | ||
J Biol Chem Forkhead Box O3A (FOXO3) and the Mitochondrial Disulfide Relay Carrier (CHCHD4) Regulate p53 Protein Nuclear Activity in Response to Exercise. | ||
FEBS Lett TIM29 is a subunit of the human carrier translocase required for protein transport. | ||
PLoS One Megakaryocytic Differentiation of K562 Cells Induced by PMA Reduced the Activity of Respiratory Chain Complex IV. |
Reviews
What customers say
The single review for this product is a 5-star rating. The reviewer used the antibody at a 1:1000 dilution for Western Blot on heart tissue and described it as a "very good antibody." Overall, the feedback is positive, indicating strong performance in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Angela (Verified Customer) (12-27-2024) | very good antibody !
 |
